KEGG   Halobacillus halophilus: HBHAL_1940Help
Entry
HBHAL_1940        CDS       T02031                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hhd  Halobacillus halophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBHAL_1940 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_1940 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HBHAL_1940 (trpB)
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HBHAL_1940 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943136..944329
Genome map
AA seq 397 aa AA seqDB search
MLQVFPDVKGRFGDFGGKYVPETLMGPLQELEDALDQAMEDQAFHDEYHHVLEEYAGRPT
ALTYADKISDYLGGAKIYLKREDLNHTGAHKLNNAIGQALLAKRMGKEKIIAETGAGQHG
VASATVAAKFGLKCKVFMGEEDIRRQELNVFRMKLLGAEVVSVSSGNGTLKDATNEAIRY
WVANCEDHFYLIGSVVGPHPYPRMVRDFQRVIGDESKKQFLEVEQELPNRIYACVGGGSN
AMGMFYPFLEDDAELIGVEAAGRGIDTPEHAATLTKGAPGVIHGSLTYLMQDDNGQITEP
YSISAGLDYPGIGPEHAHLFQTKRVRYESITDKEALDALRLLTECEGIIPAIETAHALAQ
AFKEAGSMSKDETILINLSGRGDKDMATLMEHFEEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagtatttccagacgttaaaggcagattcggtgactttggaggcaaatatgta
cctgagacattaatgggacctcttcaggaactggaagatgctcttgatcaggctatggag
gatcaggcttttcatgatgaatatcatcatgtacttgaagaatatgcgggccgtcctaca
gctcttacgtatgcggataaaatcagtgactatttaggcggagccaagatttatctgaag
cgtgaagatctgaaccatactggagcgcataaattgaacaatgcgatcggccaggccttg
cttgctaaacgaatgggcaaggaaaagatcattgccgaaacaggtgccggccagcacggc
gtggcgtcagcaacggtagctgctaagttcgggcttaagtgcaaagtgttcatgggcgaa
gaagacattcgccgtcaggaattgaatgtattccgcatgaagcttcttggagcggaagtc
gtctccgtttcaagcggtaatggaacgctgaaagatgctacaaatgaagcgatccgctat
tgggtagccaattgtgaagaccacttctatctaattggttctgtggtcggtcctcacccg
tatccacgcatggtccgtgatttccagcgggtcatcggggacgaatcgaagaagcagttc
cttgaagtggagcaggagctgccgaaccgcatttacgcctgcgtaggcggagggagtaat
gcgatgggaatgttctacccgttccttgaagatgacgcagaattaatcggtgtggaagct
gccggccgcggaattgacaccccggaacatgcagctacgcttaccaagggtgctcctggc
gttatccatggttcccttacgtatttgatgcaggatgataatggacagattacagaacct
tattccatttctgctggtctcgattatccgggcatcggccctgaacacgctcatctgttc
cagacgaaacgagtacgctatgaatctatcacggataaagaagccttagatgctcttcgc
ctgttaacggaatgtgaaggaattatcccggctattgaaaccgctcatgcgcttgctcag
gctttcaaagaagccggcagcatgtctaaagatgaaactatattaattaacctgtccggc
cgtggagataaagacatggcgacgctgatggaacatttcgaggaggaggtttag

DBGET integrated database retrieval system