KEGG   Halobacillus halophilus: HBHAL_1956Help
Entry
HBHAL_1956        CDS       T02031                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
hhd  Halobacillus halophilus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HBHAL_1956 (xylA)
   00051 Fructose and mannose metabolism
    HBHAL_1956 (xylA)
Enzymes [BR:hhd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     HBHAL_1956 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961833..963161
Genome map
AA seq 442 aa AA seqDB search
MAYFNNIDKIKYEGSESTNPYAFKFYNPEETINGQTMEEYLRFGVAYWHTFTEDLSDPFG
VGTAQRPWDRYEGMDLAKARVEAAFEFFEKLNVPYFCFHDVDIAPEGNSLRESNENLDTI
VSMIKDYMKDSKTKLLWNTVNNFTHPRFVHGAASSSEADVFAYAAAKVKKGLEVGKELGS
ENYVFWGGREGYETLLNTDMKLELDNLGRFYHMAVNYAKEIGFDAQFLIEPKPKEPTTHQ
YDFDVASGYAFLQKYDLQDHFKFNIEANHATLAGHTFEHELHYARINNVLGSVDANQGHP
LLGWDTDEFPTDLYSTTLAMYEIIKNGGLGRGGLNFDAKVRRGSFKPEDLFHAHIAGMDS
FAVGLKVAQKLLEDGGLENIIEDRYSSYKDGIGKDIVNGTTDFHKLEQHALGLESISQPS
GRLENIKAIINQYLLKTFAGEK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcttattttaacaatatcgataaaattaaatacgaaggttctgaatcaacaaatcca
tacgcatttaagttctacaatccggaagaaacgattaacgggcagacgatggaggaatat
cttcgattcggggtggcttactggcacacatttacggaagatctatccgatccatttggt
gtaggtaccgcccagcgtccgtgggaccgatatgaagggatggaccttgcgaaggcaaga
gtagaagccgcttttgaattctttgaaaaactgaatgttccttacttctgcttccacgat
gtcgatattgctccggaaggaaacagcttacgagagtctaacgagaacctcgacacgatt
gtcagtatgatcaaggattatatgaaagacagtaaaacgaagctgctttggaatacggtg
aataatttcacccacccgcgctttgttcacggtgcagcttcatccagtgaagcggatgta
tttgcgtatgcggctgcaaaagtgaagaagggacttgaagtcggaaaagaactcggttca
gaaaactatgtattctggggcggacgcgaaggttatgaaacgctgctgaatacggatatg
aagctggaacttgataacctcggccgcttctaccatatggcggtgaactatgcgaaggag
atcggattcgatgctcagttcttaattgagccgaagccaaaagagccaactacgcatcaa
tacgatttcgacgtagcttctggttatgcatttttgcaaaaatatgatcttcaggatcac
tttaaattcaatatagaagctaaccatgccacgcttgctggtcatacgttcgagcatgaa
cttcattatgcccgcattaataatgtgctgggatcggtggatgctaaccagggccatcct
ctgctaggatgggataccgatgaattcccaacagacctttactctacaacacttgctatg
tatgaaattattaaaaatggcggattaggacgcgggggcttgaactttgatgcgaaggtc
cgccggggatcctttaagccggaagatttattccacgctcacattgctggaatggacagt
tttgcggtcggattaaaggttgcgcagaaactgcttgaggacgggggacttgaaaatatt
atcgaggatcgctacagcagctataaagatgggattggcaaggatattgtaaatggtaca
actgatttccataagcttgaacagcatgctcttggattggaaagtatctctcagccatcc
ggccgcctggaaaatattaaagccatcattaaccaatacctgctgaaaacttttgcagga
gagaagtaa

DBGET integrated database retrieval system