KEGG   Halobacillus halophilus: HBHAL_2032Help
Entry
HBHAL_2032        CDS       T02031                                 

Definition
short-chain dehydrogenase/reductase family protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hhd  Halobacillus halophilus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HBHAL_2032
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HBHAL_2032
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     HBHAL_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041442..1042218
Genome map
AA seq 258 aa AA seqDB search
MVKNKVVFITGAASGIGYEIGMEFAKNGAKVVLSDMNEKKVMEAATEVTEAGYQAIGLTC
DVTKETELQEAIDKTVEQYGRLDVLINNAGLQHVASIEEFPTEKFEFITKVMLVAPFMAT
KHVFKIMKKQGFGRIINMASINGLIGFAGKSAYNSSKHGVIGLTKVTALEGAEHGITVNA
VCPGYVDTPLVRNQLQDLAANRGVSLEKVLEEVIYPLVPQKRLLSVQEISDYTLFLASDK
SKGVTGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaataaagttgtatttatcacaggagccgcaagcggtatcggatatgaaatt
ggaatggaatttgcaaagaatggagcaaaggtcgttttgagcgacatgaacgaaaagaag
gtaatggaagcagcgactgaagttaccgaagcaggctatcaggccatcgggctgacgtgc
gatgtgacgaaagaaacggagctgcaagaagcaattgataaaactgtggagcaatatgga
cgattagatgtgctgatcaacaatgcaggattacagcatgtagcctctatagaagaattt
ccgaccgaaaaatttgaattcattacgaaagtgatgctggtcgctccgtttatggcaacc
aagcatgtatttaagattatgaaaaaacaagggttcggtcggatcatcaatatggcttct
atcaatggtctaatcggatttgcaggcaagtccgcttacaatagctccaaacacggagtg
atcggcctgacgaaagtaacggcgcttgaaggagcggaacatggaattaccgtcaatgcg
gtctgtccgggttatgtggatacaccacttgtccgtaaccagctgcaagatttagcagct
aatcgaggggtgtccctggaaaaggtactggaagaagtaatttacccgcttgtcccgcag
aaacgtttgctttcggtacaggagatatccgattacacattgtttttggctagtgataaa
tcaaaaggggtaaccggccaggctgtggttatagatggcggttacaccgctcaataa

DBGET integrated database retrieval system