KEGG   Halobacillus halophilus: HBHAL_2032Help
Entry
HBHAL_2032        CDS       T02031                                 

Definition
short-chain dehydrogenase/reductase family protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hhd  Halobacillus halophilus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hhd00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hhd00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041442..1042218
Genome map
AA seq 258 aa AA seqDB search
MVKNKVVFITGAASGIGYEIGMEFAKNGAKVVLSDMNEKKVMEAATEVTEAGYQAIGLTC
DVTKETELQEAIDKTVEQYGRLDVLINNAGLQHVASIEEFPTEKFEFITKVMLVAPFMAT
KHVFKIMKKQGFGRIINMASINGLIGFAGKSAYNSSKHGVIGLTKVTALEGAEHGITVNA
VCPGYVDTPLVRNQLQDLAANRGVSLEKVLEEVIYPLVPQKRLLSVQEISDYTLFLASDK
SKGVTGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaataaagttgtatttatcacaggagccgcaagcggtatcggatatgaaatt
ggaatggaatttgcaaagaatggagcaaaggtcgttttgagcgacatgaacgaaaagaag
gtaatggaagcagcgactgaagttaccgaagcaggctatcaggccatcgggctgacgtgc
gatgtgacgaaagaaacggagctgcaagaagcaattgataaaactgtggagcaatatgga
cgattagatgtgctgatcaacaatgcaggattacagcatgtagcctctatagaagaattt
ccgaccgaaaaatttgaattcattacgaaagtgatgctggtcgctccgtttatggcaacc
aagcatgtatttaagattatgaaaaaacaagggttcggtcggatcatcaatatggcttct
atcaatggtctaatcggatttgcaggcaagtccgcttacaatagctccaaacacggagtg
atcggcctgacgaaagtaacggcgcttgaaggagcggaacatggaattaccgtcaatgcg
gtctgtccgggttatgtggatacaccacttgtccgtaaccagctgcaagatttagcagct
aatcgaggggtgtccctggaaaaggtactggaagaagtaatttacccgcttgtcccgcag
aaacgtttgctttcggtacaggagatatccgattacacattgtttttggctagtgataaa
tcaaaaggggtaaccggccaggctgtggttatagatggcggttacaccgctcaataa

DBGET integrated database retrieval system