KEGG   Halobacillus halophilus: HBHAL_2097Help
Entry
HBHAL_2097        CDS       T02031                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hhd  Halobacillus halophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBHAL_2097 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HBHAL_2097 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    HBHAL_2097 (odhB)
Enzymes [BR:hhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HBHAL_2097 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1113140..1114486
Genome map
AA seq 448 aa AA seqDB search
MKEIKVPELAESITEGTIAEWLVQKGDQVEKGDPILELETDKVNVEVNADASGVISELLK
EAGDDVEVGDVIAKVDENGEAGGSSEEESSSEEEEQEASEENKQAQEDKEQQQETKESKQ
QEESKDDQQKGSNGDDKKEVIATPAARKRARELGINLSEISARDPLGRIRPEDVEEAAQG
GGKKEQKQEPKQEDKKEAPKKEKKSEQSSEKTEFEKPVERVKMSRRRQTIAKRLVEVQQT
SAMLTTFNEVDMTNVMNLRSQRKESFQKKHDIKLGFMSFFTKAVVGALKEFPLINAEIQG
NEIVMKKFYDIGMAVSTEEGLVVPVVRDADRLDFAGIEKGIADVATKARNKELQLEDLQG
GSFTITNGGIFGSMLSTPILNSPQVGILGLHNIEKRPKVMPDDTIQARPMMYIALSYDHR
IVDGKEAVQFLKRIKEMIEDPYDLLLEG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaattaaagttcctgaattagctgaatccattacagaaggtacgattgctgaa
tggcttgttcaaaaaggagatcaggttgagaaaggtgatcctattcttgaactcgagaca
gataaagtaaacgtcgaagtaaacgctgatgcaagcggtgttatttcggaacttctaaaa
gaagctggagatgacgtagaagtaggggacgttatcgctaaggttgatgaaaacggagaa
gccggcggaagctcggaagaagaatcctccagtgaagaagaggaacaagaagcttctgag
gagaacaaacaagctcaagaagataaagagcaacagcaagaaaccaaagagtccaaacaa
caagaagagtctaaagatgatcagcagaaaggctccaatggtgacgacaaaaaagaagtc
attgctactccagcggctcgtaaacgagcgcgtgagcttggaattaacctgagtgagatt
tctgcgagagatccacttggccgcatccgtccggaagatgtagaagaagcggcacaaggc
ggaggcaagaaggagcagaaacaggaacctaagcaggaagataaaaaagaagctcctaaa
aaagagaaaaaatcagaacaaagtagtgaaaagacagagtttgaaaagccggtggaacga
gttaaaatgtcccgccgccgtcaaacaattgcgaagcgtctcgtagaggtacaacaaact
tccgcgatgcttacaacgttcaatgaagttgatatgacgaatgtgatgaaccttagaagc
cagcgcaaagaatccttccagaagaaacacgatattaaactaggattcatgtctttcttt
acgaaagctgtggtaggcgcattgaaagagttccctctaatcaatgcggaaatccagggc
aatgaaattgttatgaagaaattctatgatattggtatggctgtatctacggaagaaggc
ctcgttgttccagttgtccgcgatgcggatcgtctggatttcgcaggaattgaaaaagga
attgctgacgtggcaacgaaagcccgtaataaggaacttcagttggaagatctgcagggt
ggttcctttacgattacaaatggcggtattttcggctccatgctttccacgccgatcctg
aattctccgcaagtcggtatcctgggtctgcacaatattgaaaagcgtccgaaggttatg
ccggatgataccattcaagctcgccctatgatgtatattgctctttcatacgatcaccgg
atcgtggacggcaaagaagctgtacagttcctgaagagaattaaagaaatgattgaagat
ccttatgatttattactagaaggataa

DBGET integrated database retrieval system