KEGG   Halobacillus halophilus: HBHAL_2268Help
Entry
HBHAL_2268        CDS       T02031                                 

Gene name
asnO
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hhd  Halobacillus halophilus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hhd00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283730..1285571
Genome map
AA seq 613 aa AA seqDB search
MCGIVGWIDYKNKVQNKTPLLERMADTIRHRGPDDYQTWLDGPAAFGHQRLIVVDPNGGK
QPMVREAHDEQYVLCYNGELYNTDEVRDTLKAKGWTFRSHSDTEVVLVSFMEWGRECVER
LNGIFAFSIWEKKRKRLFLARDRLGVKPLFVRHQPDGLMFASEMKAILAHPDVEARVGAE
GIQEILTLGPSRTPGHGIFETLQELRPGHRAFWEKGKLSIERYWNVKSAEHTDTWDETVA
RVRELFIDASERQLVSDVTLGTFLSGGVDSSAITAVAAEKYKNEQKGALQTFSIDYKDQD
KFFKKSAFQPDRDEAYIKKVSSQHQTRHYVMEATPEDLISRLKQAVTLRDLPGMADVDSS
LLWFCEQIKKHVTVALSGECADEIFGGYPWFYRKEDQERKGFPWIRSLDERMNLVKTDVS
QSVNMEAYMLKRYQETIDETPVLAGEDEKAVKHRQMSYLNMNWFMQTLLERKDRMSMGAS
LEVRVPFSDHRLVEYAWNIPWSMKFHGDQEKGLLREALRGVLPDEVLFRKKNPYPKTFHP
AYTKAVCTWMNEIVADANAPLFDLFDRKKVRKLNDSEGQAIGAPWFGQLMTGPQLIAHLC
QINYWLKTYHVRL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgtgggttggattgattacaaaaataaagtgcagaataaaacccctctt
ttagaaaggatggccgataccatccggcaccgtggtccagacgattatcaaacgtggctg
gatgggccggcagctttcggacaccagcgtctaattgttgtagacccgaacggcgggaaa
cagccgatggtacgggaggcacatgacgaacagtatgtgctttgctataacggtgagtta
tataatacggatgaagtacgagatacattaaaagcgaaaggctggacgttccgctctcat
tcggatacggaggttgtccttgtcagttttatggagtggggcagagaatgcgtggagcga
ttaaacggtattttcgccttcagtatttgggagaaaaagagaaagcgtctgtttttagct
agagaccggctcggggttaagccattgtttgttcgtcatcagccggatggtctgatgttt
gcttctgagatgaaagccatccttgcccatccggacgtagaagcaagggttggagcggaa
ggaattcaggaaattcttacgcttggaccttcgagaacaccggggcacggcatttttgaa
acgttgcaggaacttcgtccaggtcaccgggcgttttgggaaaaaggaaagctttcgatc
gagcgttactggaatgtgaagagcgccgagcacaccgacacatgggatgagaccgtagca
cgtgtgagggagttatttattgatgcttccgaacggcagctcgtttcggatgtaacacta
ggtacttttttatcgggcggggtggactcaagtgccattacggctgtagccgctgaaaaa
tacaaaaatgaacaaaagggcgcgctgcagaccttttcgattgattataaagatcaggat
aaattctttaagaagagcgcttttcagccggaccgtgatgaagcttatattaagaaagtc
tcaagccagcatcagacccgtcattacgtgatggaagcgacgcctgaagacctaatatca
aggctgaagcaggccgtaacactacgggatttgccagggatggcagatgttgattcctca
ttgctgtggttttgtgaacaaattaaaaaacatgtaacggttgcgttgtcaggggaatgc
gctgatgaaatatttggaggctatccgtggttttatagaaaagaagatcaggagcgaaaa
ggatttccttggatccggtccttagatgaacgaatgaatttagtaaaaacggatgttagt
cagagtgtgaatatggaagcgtacatgttgaaacgttatcaggagacgatcgatgaaacg
ccggttcttgcaggagaagacgaaaaagcggtgaaacaccgacagatgtcttacctcaat
atgaactggtttatgcagacgctccttgagcgtaaggaccggatgagtatgggggcaagc
cttgaggttcgtgtacctttcagcgatcatcgtctggtggaatatgcgtggaatattccg
tggagcatgaaatttcacggggatcaggaaaaaggtttgcttcgtgaagcgttgcgcggc
gtacttcctgatgaagtgctgttccgaaagaaaaatccatatccaaaaacgtttcacccc
gcttatacaaaagccgtctgtacatggatgaatgaaatagtagccgatgcgaatgctcca
ctgttcgatcttttcgaccgtaaaaaagtgaggaagcttaatgattcagaaggtcaggcg
atcggagccccatggtttggtcagttaatgacaggaccacagctaatcgctcacctctgt
caaattaattattggctcaaaacctatcacgtacgtttgtaa

DBGET integrated database retrieval system