KEGG   Halobacillus halophilus: HBHAL_2373Help
Entry
HBHAL_2373        CDS       T02031                                 

Definition
(GenBank) pyruvate dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00020  Citrate cycle (TCA cycle)
hhd00620  Pyruvate metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
Module
hhd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2373
   00020 Citrate cycle (TCA cycle)
    HBHAL_2373
   00620 Pyruvate metabolism
    HBHAL_2373
Enzymes [BR:hhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HBHAL_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 GCV_H DNA_Packaging HlyD_D23
Motif
Other DBs
NCBI-ProteinID: CCG44719
UniProt: I0JKQ0
Position
1366927..1368162
Genome map
AA seq 411 aa AA seqDB search
MDVKLHDIGEGMHEAEILYYFVKKGDFVKNDAPLVEVQTDKMTAELTAPAEGVIEEINYD
VGDVIEVGTTILTMRSEQKQSSKQPVLAGQTAGTETNQSSGPRNFNWELPSTRVKASPHT
RRIAREQGIKIEDVQGTGKGGRILDEDIFAFMETKSKPSPVKEEEEVKKQPPVERAGQQQ
TIPFRGRRKQIAKKMTQSLYTAPHVTHFDEVDMTEVLKVKDQLKKGTDRRPGVQVSVAAF
FIKALQLSLKEFPIFNSKLDEEKGEILLESSYNIGLATGTEEGLIVPVLKNVENLSLIDI
HKQMKDLTKKAVDNKLSGHDLRGGTFTISNVGPMGSTGATPILNYPETGLMAFHKTKKMP
VVIDDEIVIRQMMNVTLTFDHRVADGSQSVAFTNRFIDYIENPYVMLIELI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgaaattgcatgatattggggaaggaatgcatgaagctgaaattctttattat
tttgtgaaaaaaggggattttgtgaagaatgacgctccacttgttgaagttcagacggac
aaaatgacggctgaactgaccgcgccagcagaaggagtcattgaggaaattaattatgat
gtaggcgatgtgattgaagtgggcacgaccattttaacgatgaggtctgaacaaaagcag
tcctctaagcagcccgtacttgccggacagacggctggtacagagacgaaccaaagttcc
gggccaagaaactttaattgggagcttccatctaccagggtgaaggcttcccctcataca
cggaggattgccagagaacagggcatcaagattgaagacgttcagggtacaggaaaagga
ggacgtatcctcgatgaagatatcttcgcatttatggaaaccaaatcgaagccttctcct
gtaaaagaagaagaggaagtgaaaaaacagccgccagtcgaacgagcaggacagcagcaa
accatcccatttagaggccggcgaaaacaaattgccaaaaaaatgacccaatcgctttat
acggctccccatgtcactcattttgatgaagtggatatgacggaagtattaaaggtgaag
gatcagctgaaaaaaggtacagaccgtcgtccaggcgtccaagtatcagttgccgccttt
tttatcaaagctctccagctatcccttaaagaatttccgatattcaactctaaattagac
gaagagaaaggagaaatccttttagaatcgtcttacaatatcggactcgccaccggaaca
gaggaaggattaatcgtacctgtcttaaaaaacgttgaaaatctatcattaatagacatc
cataaacagatgaaagatttaacgaaaaaggcggtagataataagctatctggacatgat
ttacggggaggaacctttaccattagtaacgttggaccgatgggaagcaccggggcgaca
ccgattttaaattatccagaaacgggtttgatggcctttcataaaacgaaaaaaatgcca
gtggttattgatgatgaaattgtcattagacagatgatgaatgtgacgctgacttttgat
caccgagttgccgatggttcgcaatccgttgcctttacgaaccggtttattgactatatt
gaaaatccatatgtgatgctaatcgaattaatctag

DBGET integrated database retrieval system