KEGG   Halobacillus halophilus: HBHAL_2602Help
Entry
HBHAL_2602        CDS       T02031                                 

Gene name
fbp1
Definition
fructose 1,6-bisphosphatase, class III (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
hhd  Halobacillus halophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBHAL_2602 (fbp1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2602 (fbp1)
   00030 Pentose phosphate pathway
    HBHAL_2602 (fbp1)
   00051 Fructose and mannose metabolism
    HBHAL_2602 (fbp1)
  Energy metabolism
   00680 Methane metabolism
    HBHAL_2602 (fbp1)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HBHAL_2602 (fbp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1605973..1607904
Genome map
AA seq 643 aa AA seqDB search
MNTKYLDLLAQKYDSEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGK
VKEKITDLFAEELSEKEMNEFATLVYYPEEKIRLIKNSFDNEKELNHWYGQIIERMLKLV
SYASSKYTRSKLRKALPSQFAYVIEELLYKTDEFTNKEQYYSKILQQIISLGQSDKLIIG
LAYTTQQLVVDHLHVVGDVYDRGPEPDKIMETLINYHSIDIQWGNHDVLWIAAYAGSKVC
LANIIRICARYNNLEIIEDAYGINLRPLLNLAEKYYDDNPAFRPKINPGEEPSDHERLQI
TKIHQAIAMIQFKLESPIIKRRSYFNMEDRLLLEKVDYDRNEITIHGETYPLEDTCFATV
DPEHPEQLLEEEEQVMEKLLFSVQHSEKLARHMNFFMKKGSLYLKYNGNLLIHGCIPLDE
QGNMEKMTIENRTYGGRELLDVFEHYLRYAFAHPEKTDDLATDMSWYLWTGEYSSLFGKR
EMTTFERYFIKDKKVHKERKNPYYHLREDEETCREILTDFGLNPDQGHIINGHTPVKEID
GENPIKANGKMIVIDGGFSKAYQSKTGIAGYTLLFNSYGMQLVAHQHFNSKEEVLRNGTD
VLSVKRLVDKELERKKVLETNVGEELLQEIYILNSLMEYRYIN
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacaaaatacctggacttactcgcccaaaaatatgatagtgaagaaaaagtggtc
actgaaattattaatcttaaagctatacttaatctgcccaaaggcacagagcattttgtc
agcgatttgcacggggagtatcaagcctttcaacatgtattaagaaatggttcagggaaa
gtaaaagagaaaatcaccgatctatttgccgaagagttatccgaaaaagaaatgaatgag
ttcgcgacgctagtctattacccagaagaaaagatcaggctgatcaaaaacagctttgat
aatgaaaaagaattgaaccattggtatgggcaaatcatcgaacgtatgttgaagcttgtt
tcatatgcttcctccaaatatacccgatccaaacttcggaaagccttacccagccagttt
gcgtacgttattgaagagctgctttacaaaacagatgaattcaccaataaggagcagtat
tattctaagattcttcagcagattatctccctcggccagtcggataagctcatcatcggt
ctcgcttataccacccagcagctggtggtggaccatcttcatgtcgtgggagatgtgtat
gatcgaggtcccgaacctgacaaaatcatggaaaccctcattaattatcactcgattgat
attcagtgggggaatcatgatgtcctatggattgcagcctatgcaggctcaaaggtctgt
ctcgctaatatcattcgaatctgcgcacgctacaacaatttagagattatcgaagatgcg
tatggaattaatcttagaccgcttcttaatcttgcagagaaatactatgacgacaatcct
gccttccgtcctaagatcaatccaggcgaagaaccatctgatcatgaaagattacaaatt
acgaagattcaccaggccattgccatgattcagttcaaactggaaagccctattatcaaa
agacgctcctatttcaatatggaagatcgacttttgcttgagaaagtagattacgacagg
aatgaaatcaccatccacggggaaacctacccccttgaagatacctgctttgccacggtg
gatcctgagcatcctgaacagcttctagaggaagaagagcaagtgatggagaaactatta
ttctctgttcagcattcagaaaagctggccagacacatgaactttttcatgaaaaaagga
agtctttatctgaaatataacgggaacttattaattcatggatgcattccgctggatgaa
caaggaaacatggaaaaaatgacgattgaaaatcgaacctatggcggaagagaattactt
gatgtttttgagcactatctacgttacgcttttgcccatcctgaaaagaccgacgatctt
gcaacggacatgtcctggtatttatggacaggggaatattcctctcttttcgggaaacgg
gagatgaccacgttcgaaaggtactttattaaagataagaaagtccataaagaaagaaaa
aacccttattatcatttgcgggaagatgaggagacctgccgggaaatactcactgacttt
ggtctgaatccagaccaggggcatatcatcaatggccacacaccggttaaagaaatagat
ggggaaaatcccattaaagccaatggaaagatgattgtaatcgacggaggattttccaag
gcttatcaatccaaaacgggcatagccggctacacgttattatttaattcctacggcatg
cagctggttgctcaccaacactttaattctaaagaggaagtgctgcgaaatggaacggat
gtcttatcggtgaaaagattggtggataaggagcttgagaggaaaaaggttcttgaaaca
aatgtgggagaggaattactgcaggaaatttatattttgaacagtttgatggaatatcgt
tatataaattga

DBGET integrated database retrieval system