KEGG   Halobacillus halophilus: HBHAL_2681Help
Entry
HBHAL_2681        CDS       T02031                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hhd  Halobacillus halophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HBHAL_2681
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HBHAL_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1684429..1685235
Genome map
AA seq 268 aa AA seqDB search
MSELQGKRVAVAADRRAEEIGTLIRNFGGEPVVYSIQGKMNLDESTSAGNVRDLIAGSFD
WVILTTGIGARTLADSAHKNELHEDFIEKLRTSRLAIRGKKTTDWMKEHQLKPELLAADG
TMAELMKELRAAPERGSVFLQAYNLDDAKWKSTLEEMGHEVYLSQPYSFEKPKTAHLQEL
KMEIFDQSVEAVVFTSKTQVKNLFEDTEDQETLIHKFNDQVLAVAVGKVTAKELEDQGIT
EVLQPENQKMGAMVVKLNQYFKQLTQSY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactgcaaggaaagcgggtggccgtagcagctgatcgaagagcggaagaaatc
ggaacactgatccggaattttggcggagaaccagtggtgtattctattcagggaaaaatg
aacctggatgaatccacaagcgctggaaacgtccgcgatttgatcgccggttcatttgat
tgggtgatcttaacgacaggaatcggagccagaacgcttgccgactcggctcataagaat
gagttgcacgaggattttatagaaaaattaagaaccagccgactggccatacgtgggaag
aagacgacggactggatgaaagaacatcaacttaagcccgaactactggctgctgatggg
acgatggctgaactgatgaaggaattgagagcggcgccggaacgaggaagcgtatttctt
caagcctataaccttgacgatgcgaagtggaaatcgaccctggaagagatggggcatgag
gtttatctctctcagccttactcctttgaaaaaccgaaaacagcccatcttcaggaatta
aaaatggagatttttgaccaatctgtcgaagcggttgtatttacaagtaaaacgcaagta
aaaaatttatttgaggataccgaagatcaggaaaccttaattcacaagtttaatgaccag
gtactggcggttgcggttggaaaagtaacagcaaaagagctggaagatcagggaattact
gaagttctccagccggaaaatcagaaaatgggtgccatggtagttaaactgaatcaatac
tttaaacagctgacccaaagttattaa

DBGET integrated database retrieval system