KEGG   Halobacillus halophilus: HBHAL_2810Help
Entry
HBHAL_2810        CDS       T02031                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00020  Citrate cycle (TCA cycle)
hhd00620  Pyruvate metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
Module
hhd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2810
   00020 Citrate cycle (TCA cycle)
    HBHAL_2810
   00620 Pyruvate metabolism
    HBHAL_2810
Enzymes [BR:hhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HBHAL_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H ATP-synt_ab_Xtn HlyD_3 HlyD_D23 TFIIF_alpha FancD2
Motif
Other DBs
NCBI-ProteinID: CCG45158
UniProt: I0JLY8
Position
1812809..1814125
Genome map
AA seq 438 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIAKWFVKPGDEIKEDDVICEVQNDKAVVEIPSQVDGTVKEIH
VEEGETTTVGTVIITIDDGSEDTGSDEGSSDDSAEETKQEPKEEKQSEQKEEKSASEQPA
AEGDSDVDEDKRVVAMPSVRKFARDNDVDIRKVQGSGKNGRILKEDVESFMSGDQTEAAA
DTASEESEEQETAAAAQTAPAAGEAYPETREKMSGMRKAIAKAMVNSKQTAPHVTLMDEV
DVTELVAHRKKFKAVAAEQDIKLTYLPYVVKALVSTLKKYPVLNTSLDDDKDEIIQKHYY
NIGIAADTDKGLLVPVVKDSDRKSIFSISSEVNELAVKARDGKLTSEEMKGASTTITNIG
SAGGQWFTPVINHPEVAILGIGRIAEKPMVRDGEVVVAPVLAISLSFDHRIIDGATAQHA
MNNIKRLLNDPQLIMMEA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactgcctgatatcggtgaaggtatccacgaaggtgaaattgcc
aaatggtttgtaaaaccaggtgatgaaattaaagaagacgacgtcatttgcgaagtgcaa
aacgacaaagcagttgttgaaattccgtctcaagtcgatggtacagtaaaagaaatccat
gtcgaagaaggcgaaacaactacagtaggaacggtcattatcacaatcgatgacggctcc
gaagacacaggttctgatgaaggatcttctgatgattccgcagaggaaactaaacaagag
ccgaaagaagaaaaacaatcagagcaaaaagaagaaaaatctgcttctgaacagcctgca
gctgaaggtgacagtgatgtagatgaagacaagcgtgtagtagctatgccgtccgtgcgt
aaatttgcccgcgacaacgatgtagatatccgtaaagtacaaggctctggtaaaaacggc
cgtatcttgaaagaggatgtcgagagcttcatgagcggcgaccaaaccgaggcggcagcg
gatacagcaagcgaagaatcagaagagcaagaaacagcagccgcggctcagacagcccca
gcagctggagaagcgtatcctgaaactcgcgagaaaatgagcggtatgcgtaaagccatt
gctaaagctatggtgaattctaagcagacagctcctcacgtaacccttatggatgaagta
gacgtgacagaacttgttgctcaccgtaagaaattcaaagcagtagctgctgaacaggat
attaagcttacttacttgccttatgtagtaaaagcgcttgtatcaacgcttaagaaatat
ccagtattaaatacgtcactagatgacgataaagatgaaattattcaaaaacactattat
aatattggtattgcagcagacactgacaaaggcttgcttgtaccagtggtgaaagattca
gaccgtaagtcaatcttctccatttcaagtgaagtcaatgaattggcagtcaaagctcgc
gatggtaaactgacatccgaagaaatgaaaggcgcatctacaacgattacaaatatcgga
tctgccggcggacaatggtttactccagtaatcaaccatccagaagttgctattctagga
attggacgtattgctgaaaaaccaatggttcgtgatggcgaagtagttgtagctcctgtt
cttgctatttccctaagctttgaccaccgtattatcgatggtgcaacagctcagcatgca
atgaataacatcaagcgtttactgaacgatccacaactaattatgatggaggcgtaa

DBGET integrated database retrieval system