KEGG   Halobacillus halophilus: HBHAL_2810Help
Entry
HBHAL_2810        CDS       T02031                                 

Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hhd  Halobacillus halophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBHAL_2810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2810
   00020 Citrate cycle (TCA cycle)
    HBHAL_2810
   00620 Pyruvate metabolism
    HBHAL_2810
Enzymes [BR:hhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HBHAL_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1812809..1814125
Genome map
AA seq 438 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIAKWFVKPGDEIKEDDVICEVQNDKAVVEIPSQVDGTVKEIH
VEEGETTTVGTVIITIDDGSEDTGSDEGSSDDSAEETKQEPKEEKQSEQKEEKSASEQPA
AEGDSDVDEDKRVVAMPSVRKFARDNDVDIRKVQGSGKNGRILKEDVESFMSGDQTEAAA
DTASEESEEQETAAAAQTAPAAGEAYPETREKMSGMRKAIAKAMVNSKQTAPHVTLMDEV
DVTELVAHRKKFKAVAAEQDIKLTYLPYVVKALVSTLKKYPVLNTSLDDDKDEIIQKHYY
NIGIAADTDKGLLVPVVKDSDRKSIFSISSEVNELAVKARDGKLTSEEMKGASTTITNIG
SAGGQWFTPVINHPEVAILGIGRIAEKPMVRDGEVVVAPVLAISLSFDHRIIDGATAQHA
MNNIKRLLNDPQLIMMEA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaactgcctgatatcggtgaaggtatccacgaaggtgaaattgcc
aaatggtttgtaaaaccaggtgatgaaattaaagaagacgacgtcatttgcgaagtgcaa
aacgacaaagcagttgttgaaattccgtctcaagtcgatggtacagtaaaagaaatccat
gtcgaagaaggcgaaacaactacagtaggaacggtcattatcacaatcgatgacggctcc
gaagacacaggttctgatgaaggatcttctgatgattccgcagaggaaactaaacaagag
ccgaaagaagaaaaacaatcagagcaaaaagaagaaaaatctgcttctgaacagcctgca
gctgaaggtgacagtgatgtagatgaagacaagcgtgtagtagctatgccgtccgtgcgt
aaatttgcccgcgacaacgatgtagatatccgtaaagtacaaggctctggtaaaaacggc
cgtatcttgaaagaggatgtcgagagcttcatgagcggcgaccaaaccgaggcggcagcg
gatacagcaagcgaagaatcagaagagcaagaaacagcagccgcggctcagacagcccca
gcagctggagaagcgtatcctgaaactcgcgagaaaatgagcggtatgcgtaaagccatt
gctaaagctatggtgaattctaagcagacagctcctcacgtaacccttatggatgaagta
gacgtgacagaacttgttgctcaccgtaagaaattcaaagcagtagctgctgaacaggat
attaagcttacttacttgccttatgtagtaaaagcgcttgtatcaacgcttaagaaatat
ccagtattaaatacgtcactagatgacgataaagatgaaattattcaaaaacactattat
aatattggtattgcagcagacactgacaaaggcttgcttgtaccagtggtgaaagattca
gaccgtaagtcaatcttctccatttcaagtgaagtcaatgaattggcagtcaaagctcgc
gatggtaaactgacatccgaagaaatgaaaggcgcatctacaacgattacaaatatcgga
tctgccggcggacaatggtttactccagtaatcaaccatccagaagttgctattctagga
attggacgtattgctgaaaaaccaatggttcgtgatggcgaagtagttgtagctcctgtt
cttgctatttccctaagctttgaccaccgtattatcgatggtgcaacagctcagcatgca
atgaataacatcaagcgtttactgaacgatccacaactaattatgatggaggcgtaa

DBGET integrated database retrieval system