KEGG   Halobacillus halophilus: HBHAL_2908Help
Entry
HBHAL_2908        CDS       T02031                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00230  Purine metabolism
hhd01100  Metabolic pathways
Module
hhd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HBHAL_2908 (gmk)
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HBHAL_2908 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA AAA_33 MMR_HSR1 YtxH ABC_tran AAA_29 AAA_22 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCG45256
UniProt: I0JM86
Position
1904189..1904803
Genome map
AA seq 204 aa AA seqDB search
MIDEKGILFILSGPSGVGKGTVRKALFDQSTDLRYSISMTTRNPREGEVDGTDYFFKSRE
EFEKLISEGQLIEHAEYVGNYYGTPRQYVEKTLNEGKDVFLEIEVQGALKVRENFPQGVF
IFLIPPSLEELKDRIVNRGTETEDKVKNRLHAAKEEIDMMDAYDYVVVNDEIDNAVTKVQ
SIVASEHCKRERVAHQYKKALEDE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgatagatgagaagggaatactatttatactttccggcccctcgggtgtaggaaaagga
acagtaagaaaagcactgttcgaccaatctaccgaccttcgttattccatctctatgacg
acccgcaatccccgggaaggggaagtagacgggactgattatttctttaagtcaagagag
gaattcgaaaaactgatcagtgagggtcagctgattgagcatgccgagtacgtaggcaac
tattatggaacgccgcgtcaatacgtggaaaaaacgttgaacgagggcaaggatgttttc
ttagaaattgaagtacagggcgcacttaaagtccgcgagaactttccgcaaggcgtgttc
atatttttaattccaccttctctggaggaattaaaagacagaattgtgaatcgtggcaca
gaaacggaagataaagtgaagaaccgtttgcatgcggccaaagaagaaatcgatatgatg
gacgcctacgactatgttgtcgtcaatgatgaaattgacaatgcggttacgaaagtacaa
tccattgtcgcaagtgaacattgcaaacgtgagcgagtagctcatcagtataaaaaagca
ttggaggatgaataa

DBGET integrated database retrieval system