KEGG   Halobacillus halophilus: HBHAL_2908Help
Entry
HBHAL_2908        CDS       T02031                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hhd  Halobacillus halophilus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hhd00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1904189..1904803
Genome map
AA seq 204 aa AA seqDB search
MIDEKGILFILSGPSGVGKGTVRKALFDQSTDLRYSISMTTRNPREGEVDGTDYFFKSRE
EFEKLISEGQLIEHAEYVGNYYGTPRQYVEKTLNEGKDVFLEIEVQGALKVRENFPQGVF
IFLIPPSLEELKDRIVNRGTETEDKVKNRLHAAKEEIDMMDAYDYVVVNDEIDNAVTKVQ
SIVASEHCKRERVAHQYKKALEDE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgatagatgagaagggaatactatttatactttccggcccctcgggtgtaggaaaagga
acagtaagaaaagcactgttcgaccaatctaccgaccttcgttattccatctctatgacg
acccgcaatccccgggaaggggaagtagacgggactgattatttctttaagtcaagagag
gaattcgaaaaactgatcagtgagggtcagctgattgagcatgccgagtacgtaggcaac
tattatggaacgccgcgtcaatacgtggaaaaaacgttgaacgagggcaaggatgttttc
ttagaaattgaagtacagggcgcacttaaagtccgcgagaactttccgcaaggcgtgttc
atatttttaattccaccttctctggaggaattaaaagacagaattgtgaatcgtggcaca
gaaacggaagataaagtgaagaaccgtttgcatgcggccaaagaagaaatcgatatgatg
gacgcctacgactatgttgtcgtcaatgatgaaattgacaatgcggttacgaaagtacaa
tccattgtcgcaagtgaacattgcaaacgtgagcgagtagctcatcagtataaaaaagca
ttggaggatgaataa

DBGET integrated database retrieval system