KEGG   Halobacillus halophilus: HBHAL_2971Help
Entry
HBHAL_2971        CDS       T02031                                 

Definition
alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hhd  Halobacillus halophilus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HBHAL_2971
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_2971
  Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_2971
  Amino acid metabolism
   00350 Tyrosine metabolism
    HBHAL_2971
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HBHAL_2971
   00626 Naphthalene degradation
    HBHAL_2971
Enzymes [BR:hhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HBHAL_2971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1970138..1971172)
Genome map
AA seq 344 aa AA seqDB search
MPHFNHTMKAAVVHDFKQDLEMQDVPVPKVEHGQVLVKVKASGVCHTDLHAAHGDWPVKP
NLPLIPGHEGVGEIVEAGPGVTHVKVGDRVGIPWLYSACGHCEYCLSGRETLCKDQQNAG
YSVNGSYAEYCLAHADYIVKIPDNLTYVEAAPLFCAGVTTYKALKVGNANPGDWVAIYGI
GGLGHVAVQYAKAMGFNVIAVDPFDEKLELAQQLGADRTINPLTENSAEFIQREIGGVQA
SICTAVSKQAFGEAYRAVKRGGKCVAVGLPPETMEVPIFDTVLNGVSIEGSIVGTRKDLQ
ETLQFAAEGKVKTIVETKRLEDINEIFAELEAGKINGRIVLVND
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgccccacttcaaccatacaatgaaggcagctgttgtgcatgattttaaacaagattta
gaaatgcaggatgtacctgtaccaaaagtcgaacatggccaagtactggtgaaagttaaa
gccagtggagtatgtcatacagacttacatgcagcccatggagattggccagtaaagcct
aaccttcctttaatccccggccatgaaggcgtcggtgagattgtagaggccggccccggt
gtcacccatgtaaaagttggcgatcgggtaggtattccgtggctttattccgcatgcgga
cactgtgaatactgcctttcaggacgcgaaacactttgtaaagatcaacagaatgcagga
tattctgttaatggcagttatgctgagtactgtctcgctcatgcagattacattgtcaaa
attccagataatttaacttacgttgaagctgctcctctattctgtgcaggggtgaccact
tacaaggctttaaaggtaggaaatgccaatcctggagattgggtagccatttatggaatt
ggcggccttggacatgtagctgttcaatacgccaaggctatgggatttaacgttatagcc
gttgatccgtttgatgaaaaattagaattggcacaacaattaggtgcagataggaccatt
aacccgctaactgaaaactctgcagagtttatccaacgcgaaatcggaggcgtccaggct
tctatctgtacggctgtttctaaacaagccttcggtgaggcctacagggcagttaaacgt
ggtggtaaatgcgtagcggttggactgcctccggaaacgatggaagttccaatattcgat
acggtgttaaatggagtcagtattgaaggatccattgtcggaaccagaaaggatttacaa
gagactttacagtttgcagctgaaggaaaagtaaaaactatcgttgagacaaaaagatta
gaagatattaatgaaatatttgctgagcttgaagcaggtaaaatcaatggaagaattgta
ttagtgaacgattaa

DBGET integrated database retrieval system