KEGG   Halobacillus halophilus: HBHAL_3645Help
Entry
HBHAL_3645        CDS       T02031                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hhd  Halobacillus halophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HBHAL_3645 (ruvA)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HBHAL_3645 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2605898..2606515)
Genome map
AA seq 205 aa AA seqDB search
MITYVKGQLSLIEDASITLETGGIGYEILCATPYNFQDYLNREIKIHTYHYIREDQQILF
GFRKKEDKQLFAQLLNVSGIGPKGALAILGTVSVPEFVSAIEQEDDKYLTKFPGVGKKTA
RQMILDLKGKLIVWLPDEQNEDTIFYQEELTSKEKRERIEDALEALKALGYTEKEIKLAR
TELQKTNEGSVDDYVRQGLQILMKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattacttatgtaaaaggacaattaagcttaattgaagatgcgtctataactcttgaa
acaggtggtatcggttatgagattctatgtgctaccccttacaactttcaagattatttg
aaccgcgagataaaaattcatacataccactatatacgagaagatcaacaaatattattt
ggcttcagaaaaaaagaagataaacagctgttcgcccagcttttaaatgtttcagggatc
ggtccaaagggtgctttagctatacttggtacggttagtgtccccgaatttgtttcagct
attgaacaggaagacgataagtacttaactaaattccctggtgtcggaaagaagaccgcc
aggcagatgatattggacttaaaaggcaaattgattgtatggctccctgatgagcagaat
gaagatacaattttctatcaagaggaactgacttcaaaagagaaaagagagcgtatagaa
gatgcacttgaagcattaaaggctttgggttatacagaaaaagaaattaaattggcacga
acagaacttcaaaaaaccaacgaaggcagtgttgatgattatgtcagacaagggttacag
atactgatgaagtcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system