KEGG   Halobacillus halophilus: HBHAL_3678Help
Entry
HBHAL_3678        CDS       T02031                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00860  Porphyrin and chlorophyll metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HBHAL_3678 (hemD)
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HBHAL_3678 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CCG46023
UniProt: I0JPF3
Position
complement(2637467..2638225)
Genome map
AA seq 252 aa AA seqDB search
MKPLAGKTILVTRGASQARPFVDRINKEGGEALQTPLLHFQLNDSKENQEILKKLHNYVW
VFITSSNGVKFFFELVNQYGICIPDTLRFAIIGEKTARTLKTYGYDADFMPSSFQADTMA
EEFFREESTPGMILYVRGNRSRDVLPEKFAEQQVFFQTITVYDTLLLKEHQKQIRQLICN
HEIDALTFTSPSTVQAYFAIMRDMPETGRDLPCFCIGPTTASQAEHFGFQKVFLPEHYTM
EDMVEKMVQFFS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctcttgcggggaaaacgattcttgtcacaagaggcgcatcccaggcaaggcct
tttgtagaccggataaataaggaggggggagaagctttacaaacccctctccttcatttt
caattaaatgactcgaaggagaatcaagagatcctcaagaaacttcacaactatgtatgg
gtttttattacaagctctaatggtgtgaagttttttttcgagctggtaaatcaatacggg
atttgtattccggatacattacgatttgctattattggagaaaagacagcgcgtacactt
aagacttatggatacgatgctgattttatgccatccagcttccaggctgatacaatggct
gaagagttttttagagaagaaagtactccaggcatgatcctatacgtcaggggaaaccgc
tcgagggatgttctcccagaaaaattcgcagaacagcaggtcttttttcaaacaatcacg
gtctatgatacgctactattgaaagagcatcagaaacagattcgtcaattgatctgtaat
catgagattgacgcactaacgtttacaagcccatccaccgtccaggcctattttgctatc
atgagagacatgcctgaaacaggtcgggaccttccttgtttttgcataggaccaacgacc
gccagtcaggctgagcatttcggttttcaaaaagtctttttacccgagcattatacaatg
gaagatatggttgagaagatggtgcaatttttttcataa

DBGET integrated database retrieval system