KEGG   Halobacillus halophilus: HBHAL_3718Help
Entry
HBHAL_3718        CDS       T02031                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00071  Fatty acid degradation
hhd00362  Benzoate degradation
hhd01100  Metabolic pathways
hhd01120  Microbial metabolism in diverse environments
hhd01212  Fatty acid metabolism
Module
hhd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    HBHAL_3718
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HBHAL_3718
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HBHAL_3718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: CCG46063
UniProt: I0JPJ3
Position
complement(2678778..2679551)
Genome map
AA seq 257 aa AA seqDB search
MSTLTLQVKEQVAEITIQSPPANALSSTILQDLSEEMDRIEQDESIKAILLKGEGKFFSA
GADIKEFTSLQGASDYEGLSSKGQELFNRIENFHIPVIAAIHGAALGGGLELAMACHIRY
VADDAKIGLPEINLGIVPGFAGTQRLPRYVGAPKAYEMILTGVPISGSEAASLGLANQSF
PGEEVFEQAEKLARTIASKSGPAINQVMNLIPYAHTSTFSEGVNAEASAFGEVFGNEDAK
EGIQAFIEKRKPEFKDK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaactcttacattacaggtgaaagaacaagtagcagaaattacaatacagagtcca
ccagcgaatgctctgtccagtactattcttcaggatttgtcagaagaaatggatcggatt
gaacaagatgagtcgattaaagccattttacttaaaggggaaggaaagtttttttcagca
ggagctgacattaaagaatttacctctttacaaggagcctctgattatgaaggactttca
agtaaagggcaggaactgttcaacagaatagaaaactttcatatcccggttatagcggcg
attcatggagctgcactgggcggaggcctggagcttgctatggcatgccatatacgttat
gtggcagatgacgcaaagattggtctgcctgaaatcaaccttgggattgtaccagggttt
gccggaactcagcgactgccaagatatgttggagctcctaaagcatatgagatgatatta
acaggcgttccaatatcgggaagtgaagctgcttcactcggtttggccaatcaaagtttt
ccgggtgaagaagtatttgaacaagctgaaaagctggctcgtacgattgcttctaaaagc
ggaccggcgattaatcaggtgatgaacttgatcccctatgctcatacatccacgtttagt
gaaggcgtaaacgcggaagcttcagcatttggagaagtttttggcaatgaggatgccaag
gaaggcattcaagcttttatagaaaaaagaaaaccggaatttaaagataaatag

DBGET integrated database retrieval system