KEGG   Halobacillus halophilus: HBHAL_3851Help
Entry
HBHAL_3851        CDS       T02031                                 

Gene name
ytpA
Definition
alpha/beta fold hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hhd  Halobacillus halophilus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HBHAL_3851 (ytpA)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HBHAL_3851 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2815940..2816737)
Genome map
AA seq 265 aa AA seqDB search
MKRLNSNQNLATIIIVHGAFEHAGRYHSLAESFQKGGFNVIYGDLPGQGLAEGKKGHIKN
FETYIDTVRQWLQKADSSRPVFLLGHSMGGTVVMRVMQELKPSVNGVILSSPAAGILNGA
SKSLEAVTHVINKVWPSVLVKAPFKPEYVTRNPEVIAKDKQDTLIIEKVSIRWYKEFRKA
IKKSFSEVEEFPDVPLLVMQAGEDHMVDPEKTREWFHKVGCQEKTYKEWPGFYHEIFNEP
EQEDVYNFALNFIHFQVKQADKEEL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgattaaactccaatcaaaatttagcaaccatcattattgtgcatggagcattt
gaacacgccggacgttatcattcattggctgaaagctttcaaaaaggtggatttaatgtc
atttatggtgatctgccaggccagggactagcagaaggaaagaaaggtcatataaagaat
tttgaaacctacatagatactgtgcgtcaatggctgcaaaaagcagattcttctcgtcct
gtatttttactgggacatagtatgggcgggacggttgtgatgcgggtcatgcaggaatta
aaaccgtcagtgaatggagtaattctctcgtcgcctgctgcaggtatactgaacggagcc
agcaagtctctcgaagcggtcacccatgtaataaataaggtttggccatccgtactcgta
aaagctccttttaaaccagagtatgtaaccagaaacccagaggttattgccaaagataaa
caggatactcttattatagagaaggtatctattcgatggtataaggaattccgaaaagcg
attaagaagtcattttcagaagttgaagagtttccagatgtgcctttattagtcatgcag
gcgggtgaggatcatatggtagatcctgagaaaacaagagaatggtttcataaagtcgga
tgtcaggagaaaacctataaagaatggccaggtttctatcatgaaatctttaatgaacct
gaacaggaagacgtctacaattttgctctgaattttatccactttcaagtgaaacaagct
gataaggaggagttgtag

DBGET integrated database retrieval system