KEGG   Halobacillus halophilus: HBHAL_3972Help
Entry
HBHAL_3972        CDS       T02031                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00620  Pyruvate metabolism
hhd00630  Glyoxylate and dicarboxylate metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01200  Carbon metabolism
Module
hhd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HBHAL_3972
   00630 Glyoxylate and dicarboxylate metabolism
    HBHAL_3972
Enzymes [BR:hhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HBHAL_3972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CCG46314
UniProt: I0JQ94
Position
complement(2919394..2920986)
Genome map
AA seq 530 aa AA seqDB search
METKLSGIKVEGHLDPGFEEILNQEALDFLESLHLHFEERRKQLLEKREEIQSKLDRGER
PGFLKETECIRQGNWQISDLPKDLKDRRVEITGPVDRKMVINGLNSGAKVFMADFEDANS
PTWSNTIHGQINLRDAIQKTITFQNEKGKLYQLGEQTAVLMVRPRGWHLEEKHLTYQNKA
ISGSLVDFGLYFFHNAKQLIKNGSGPYFYLPKLENHKEARLWNDIFVYAQNYMNIPQGTI
RATVLLETILAAYEMDEILYELKEHSAGLNCGRWDYIFSFLKKFRHDPSMILPDRSEVTM
TVPFMRAYSLLTIQTCHKRGAPAIGGMAAQIPVKNDPSKNEAAFQKVIADKKREVQDGHD
GTWVAHPGMVQAAMDVFNEEMPEPNQISKTKEKITVSAADLLEVPQGEITEEGLRTNINV
GIQYIASWLAGTGAAPIHHLMEDAATAEISRAQVWQWIRHPKGTLNDGRTITFELYDKLK
EEEMEAIRQEVGEDFFKKRPYKEAEKLFDSLIRNDEFEDFLTIKAYEQLS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaagttatccggaatcaaggtggaaggccaccttgatccaggttttgaagaa
atattaaaccaagaagctctggattttctagaatctttacatctacacttcgaagagaga
cgaaagcaattattagaaaaaagggaagaaattcaatcaaagttagatcgcggggaaaga
ccaggttttcttaaagaaacggaatgtatccgccaagggaactggcagataagtgatctg
ccaaaagatttaaaagatcgaagggtagaaattaccggtcccgttgatcgtaagatggtc
attaatggtctgaattctggagcaaaagtatttatggcagactttgaggatgccaactcg
ccgacgtggtcgaatacgattcacgggcagattaatttgcgggacgcgattcagaaaacc
attacttttcaaaatgaaaaaggaaaattgtatcagctgggcgaacaaactgctgtactt
atggtacgaccgagaggctggcacttggaggaaaagcacttaacctatcaaaataaagcg
atttctggaagcctggttgacttcggcttgtatttcttccacaacgctaaacagcttata
aagaacggttcgggtccatacttttatttacctaaactggagaatcataaggaagcgcga
ttatggaacgatatttttgtttacgctcagaactacatgaacattcctcaaggcactatc
agagcaacagtattattggaaacgatcctcgccgcttatgaaatggatgaaatattgtat
gaattaaaggaacactcggcaggtcttaactgcggacgctgggattatatcttcagtttc
ttaaagaaattccgtcatgatccatcaatgatacttccggaccgttcagaagtaacgatg
accgttccatttatgcgtgcttattcgctattgaccattcaaacttgtcataaacgtggc
gctcctgcgatcggggggatggcagctcaaataccagtaaaaaatgatccatccaagaat
gaagctgcttttcaaaaagtaatagctgataagaaacgagaagttcaggacggtcacgat
gggacttgggtggctcatcctggaatggttcaggcggctatggacgtattcaatgaggaa
atgccggaacccaatcaaatcagtaaaacgaaagaaaagattacagtttcagcagcagac
ttactggaagttcctcaaggggaaattaccgaagagggattacgcacaaatattaatgtg
gggattcagtacattgcctcatggctcgctggtacaggagctgcgccgattcatcatttg
atggaagatgctgcaacagctgaaatatcaagggctcaagtttggcagtggatccgtcat
ccaaaaggtacattgaatgacggacgtacaattacttttgaactttacgataagttaaaa
gaagaagaaatggaggctatccggcaagaagtaggggaggattttttcaaaaagaggccc
tataaagaagctgaaaaactattcgatagcttaattagaaatgatgagtttgaagacttt
ttaaccattaaagcttatgagcagttatcttga

DBGET integrated database retrieval system