KEGG   Halobacillus halophilus: HBHAL_4003Help
Entry
HBHAL_4003        CDS       T02031                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hhd  Halobacillus halophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBHAL_4003 (tpiA)
   01230 Biosynthesis of amino acids
    HBHAL_4003 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_4003 (tpiA)
   00051 Fructose and mannose metabolism
    HBHAL_4003 (tpiA)
   00562 Inositol phosphate metabolism
    HBHAL_4003 (tpiA)
Enzymes [BR:hhd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HBHAL_4003 (tpiA)
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HBHAL_4003 (tpiA)
  Exosomal proteins of bladder cancer cells
   HBHAL_4003 (tpiA)
  Exosomal proteins of melanoma cells
   HBHAL_4003 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2953299..2954060)
Genome map
AA seq 253 aa AA seqDB search
MRKQVIAGNWKMNKTHREAEDFIQTTKNEVPSSDKVESVVCAPFPFLQKLVEETEGTSLK
IGAQNMHFEESGAFTGEVSPVMLKELGVTYVVLGHSERREVFKETDEDINKKVHAAFKHG
LTPIICVGETLDQREADQTMNHVEAQVKKALEGLTNEQCADVIIAYEPIWAIGTGRTATA
EQANEVCAHIRETVSNYVNADAADAVRIQYGGSVKPANVDEMLSQSDIDGALVGGASLEA
DSFLKLVEAGKHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacaagtgattgcaggaaattggaaaatgaacaaaacacaccgtgaagcggaa
gattttattcaaacgacaaagaatgaggtcccatcttctgataaagtagaatctgttgta
tgtgcccctttcccgtttcttcagaaattagtagaagaaacagaagggaccagcttgaag
attggtgctcagaatatgcactttgaagaaagtggtgcattcacaggggaagtaagcccg
gtaatgcttaaagaacttggtgtaacgtatgtagttctaggccactctgagcgtcgtgaa
gtgtttaaggaaaccgatgaagatattaataaaaaagttcacgctgcgtttaaacatgga
cttactcccattatctgtgtaggggaaacactcgatcagcgtgaagcagatcaaactatg
aatcatgtagaagcccaagtgaaaaaagctcttgaaggacttacaaacgagcaatgtgcc
gatgtcattatcgcttatgagccgatctgggctattggtacaggtcgtacggctacagcc
gaacaagctaatgaagtgtgcgctcacattcgtgaaacggtcagcaactatgtgaatgca
gatgctgctgatgccgttcgtattcaatatggcggcagtgtaaaaccggctaatgttgat
gaaatgctttcccagtctgatattgacggagcgctagttggaggggcgagccttgaggct
gactctttcttaaaacttgtggaggcaggtaaacatgagtaa

DBGET integrated database retrieval system