KEGG   Halobacillus halophilus: HBHAL_4003Help
Entry
HBHAL_4003        CDS       T02031                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00051  Fructose and mannose metabolism
hhd00562  Inositol phosphate metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
hhd01230  Biosynthesis of amino acids
Module
hhd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hhd_M00002  Glycolysis, core module involving three-carbon compounds
hhd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_4003 (tpiA)
   00051 Fructose and mannose metabolism
    HBHAL_4003 (tpiA)
   00562 Inositol phosphate metabolism
    HBHAL_4003 (tpiA)
Enzymes [BR:hhd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HBHAL_4003 (tpiA)
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HBHAL_4003 (tpiA)
  Exosomal proteins of bladder cancer cells
   HBHAL_4003 (tpiA)
  Exosomal proteins of melanoma cells
   HBHAL_4003 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCG46345
UniProt: I0JQC5
Position
complement(2953299..2954060)
Genome map
AA seq 253 aa AA seqDB search
MRKQVIAGNWKMNKTHREAEDFIQTTKNEVPSSDKVESVVCAPFPFLQKLVEETEGTSLK
IGAQNMHFEESGAFTGEVSPVMLKELGVTYVVLGHSERREVFKETDEDINKKVHAAFKHG
LTPIICVGETLDQREADQTMNHVEAQVKKALEGLTNEQCADVIIAYEPIWAIGTGRTATA
EQANEVCAHIRETVSNYVNADAADAVRIQYGGSVKPANVDEMLSQSDIDGALVGGASLEA
DSFLKLVEAGKHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacaagtgattgcaggaaattggaaaatgaacaaaacacaccgtgaagcggaa
gattttattcaaacgacaaagaatgaggtcccatcttctgataaagtagaatctgttgta
tgtgcccctttcccgtttcttcagaaattagtagaagaaacagaagggaccagcttgaag
attggtgctcagaatatgcactttgaagaaagtggtgcattcacaggggaagtaagcccg
gtaatgcttaaagaacttggtgtaacgtatgtagttctaggccactctgagcgtcgtgaa
gtgtttaaggaaaccgatgaagatattaataaaaaagttcacgctgcgtttaaacatgga
cttactcccattatctgtgtaggggaaacactcgatcagcgtgaagcagatcaaactatg
aatcatgtagaagcccaagtgaaaaaagctcttgaaggacttacaaacgagcaatgtgcc
gatgtcattatcgcttatgagccgatctgggctattggtacaggtcgtacggctacagcc
gaacaagctaatgaagtgtgcgctcacattcgtgaaacggtcagcaactatgtgaatgca
gatgctgctgatgccgttcgtattcaatatggcggcagtgtaaaaccggctaatgttgat
gaaatgctttcccagtctgatattgacggagcgctagttggaggggcgagccttgaggct
gactctttcttaaaacttgtggaggcaggtaaacatgagtaa

DBGET integrated database retrieval system