KEGG   Halobacillus halophilus: HBHAL_4180Help
Entry
HBHAL_4180        CDS       T02031                                 

Gene name
gtaB2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hhd  Halobacillus halophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HBHAL_4180 (gtaB2)
   00052 Galactose metabolism
    HBHAL_4180 (gtaB2)
   00500 Starch and sucrose metabolism
    HBHAL_4180 (gtaB2)
   00520 Amino sugar and nucleotide sugar metabolism
    HBHAL_4180 (gtaB2)
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HBHAL_4180 (gtaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3136473..3137357)
Genome map
AA seq 294 aa AA seqDB search
MGKIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIKSGIEDIIIVTGKG
KRAIEDHFDKNFELEDNLMSKEKFEMLDKVNETSNVDIHYIRQKEPKGLGHAVWCARKFI
GDEPFAVLLGDDIIRSEEPGLKQLMDQYEETRSSVIGVQQVEEDQTHRYGIIDPENKNGR
LYGVKNFVEKPPKGQAPSNLAIMGRYVLTPEIMMYLDKQEKGAGDEVQLTDAIQHLNTIQ
RVFAYDFEGARYDVGEKLGFIKTTIEIALEREDLKDDVMELITELVESNEKVKS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaataaaaaaagcgattatcccggcagcagggctggggacaaggttcctccct
gcaacaaaagccatgccaaaagaaatgctgccaattgtagataaaccaactattcaatac
atagtggaagaagcaattaaatccggcattgaggatattattattgtgacaggtaaaggg
aagcgtgcgattgaagaccatttcgataaaaacttcgagctggaagacaacttaatgagc
aaagagaagtttgaaatgcttgataaggtgaacgaaacctccaatgttgatattcactac
attcgtcaaaaagagcctaaaggccttggacatgcggtctggtgtgcccgtaagtttatt
ggagatgaaccgttcgctgtccttcttggtgatgatatcatccgctcggaagaaccggga
ctgaagcagctgatggatcaatacgaagaaacgcgctcttctgttattggagtacagcag
gtagaagaggatcagacgcaccgttatgggattattgatcctgaaaataagaatggccgt
ttgtacggcgtgaaaaattttgttgagaagccgcctaaagggcaggctccatctaacctt
gcgatcatgggtcgctacgttcttacaccggagattatgatgtatctggataagcaggag
aaaggcgccggcgacgaagttcaattaacggatgccattcagcacctgaatacgattcaa
cgcgtgtttgcttatgactttgagggtgctcgctacgatgtgggtgaaaagcttggcttt
atcaaaacgaccattgaaattgcactggagcgtgaggacttgaaagacgatgtgatggaa
ttaattacggagcttgtagagtctaatgagaaagtgaaaagttaa

DBGET integrated database retrieval system