KEGG   Halobacillus halophilus: HBHAL_4357Help
Entry
HBHAL_4357        CDS       T02031                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hhd  Halobacillus halophilus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBHAL_4357
   01230 Biosynthesis of amino acids
    HBHAL_4357
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_4357
  Energy metabolism
   00680 Methane metabolism
    HBHAL_4357
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_4357
Enzymes [BR:hhd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HBHAL_4357
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HBHAL_4357
  Exosomal proteins of melanoma cells
   HBHAL_4357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3293942..3294505)
Genome map
AA seq 187 aa AA seqDB search
MTTNIYMVRHAHSTYTPDELKRPLSAEGTEEAAKVSELLIDENIEHVISSPYLRAIQTVE
GLASALGQEIHIMDGFKERKLIEGGADNFEEAIQKVWTHPRFSWEGGESNRTAQERGVRA
LKNVLVEYENKNVAIGTHGNIMVLTMNYLDNQYDYEFWKKLAMPDIYKLSFEADQFVGCK
RIWKDSY
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaatatttatatggtgcgtcacgctcattctacatataccccagatgaatta
aaaaggccgttatcagcagaaggaacagaagaagcggctaaagtcagcgaactgctcata
gatgagaatattgagcacgtaatctcgagtccttatttaagagccatacagactgttgaa
ggattagcttctgctctcgggcaagaaattcatataatggatggtttcaaagaaaggaag
ttaatagagggaggagctgataactttgaggaagcgattcaaaaagtatggactcaccca
cgtttttcctgggaaggcggagaatcaaataggaccgcccaggaaagaggcgtaagagcc
ttgaaaaacgtattagtagaatatgaaaataaaaatgtcgccatcggtacgcatggtaat
attatggtgctcaccatgaattacttggataaccaatatgattatgagttttggaagaag
cttgcgatgccagatatctataagctttcttttgaggctgatcagttcgtaggttgtaag
agaatatggaaggattcttattga

DBGET integrated database retrieval system