KEGG   Halobacillus halophilus: HBHAL_4357Help
Entry
HBHAL_4357        CDS       T02031                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00010  Glycolysis / Gluconeogenesis
hhd00260  Glycine, serine and threonine metabolism
hhd00680  Methane metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
hhd01120  Microbial metabolism in diverse environments
hhd01130  Biosynthesis of antibiotics
hhd01200  Carbon metabolism
hhd01230  Biosynthesis of amino acids
Module
hhd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hhd_M00002  Glycolysis, core module involving three-carbon compounds
hhd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_4357
  Energy metabolism
   00680 Methane metabolism
    HBHAL_4357
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_4357
Enzymes [BR:hhd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HBHAL_4357
Membrane trafficking [BR:hhd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HBHAL_4357
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HBHAL_4357
  Exosomal proteins of melanoma cells
   HBHAL_4357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CCG46698
UniProt: I0JRC8
Position
complement(3293942..3294505)
Genome map
AA seq 187 aa AA seqDB search
MTTNIYMVRHAHSTYTPDELKRPLSAEGTEEAAKVSELLIDENIEHVISSPYLRAIQTVE
GLASALGQEIHIMDGFKERKLIEGGADNFEEAIQKVWTHPRFSWEGGESNRTAQERGVRA
LKNVLVEYENKNVAIGTHGNIMVLTMNYLDNQYDYEFWKKLAMPDIYKLSFEADQFVGCK
RIWKDSY
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaatatttatatggtgcgtcacgctcattctacatataccccagatgaatta
aaaaggccgttatcagcagaaggaacagaagaagcggctaaagtcagcgaactgctcata
gatgagaatattgagcacgtaatctcgagtccttatttaagagccatacagactgttgaa
ggattagcttctgctctcgggcaagaaattcatataatggatggtttcaaagaaaggaag
ttaatagagggaggagctgataactttgaggaagcgattcaaaaagtatggactcaccca
cgtttttcctgggaaggcggagaatcaaataggaccgcccaggaaagaggcgtaagagcc
ttgaaaaacgtattagtagaatatgaaaataaaaatgtcgccatcggtacgcatggtaat
attatggtgctcaccatgaattacttggataaccaatatgattatgagttttggaagaag
cttgcgatgccagatatctataagctttcttttgaggctgatcagttcgtaggttgtaag
agaatatggaaggattcttattga

DBGET integrated database retrieval system