KEGG   Halobacillus halophilus: HBHAL_4388Help
Entry
HBHAL_4388        CDS       T02031                                 

Gene name
srfJ
Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
hhd  Halobacillus halophilus
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    HBHAL_4388 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HBHAL_4388 (srfJ)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     HBHAL_4388 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3312604..3313950)
Genome map
AA seq 448 aa AA seqDB search
MRKFTVIQSDKESASFLENKGEKSIFSNETTTARNSYITIHAEEEFQEWMGFGGAFSEAA
SYTLSQISPQNRSKVIQSYFDKKEGLAYNLGRTHINSCDFALENYTYVEENDTTLESFTI
DREKEWVLPLIHDAKEIAGEELTILSSPWSPPAWMKTNNEMNNGGKLKEEFRQLWADYYA
AYITAMEENDVKIWGVTVQNEPAVAQTWDSCEYTAEEERDFVKNYLGPTLQRAGYGDKKI
IIWDHNRDMIVERASAVLSDPEAAQYVWGTGNHWYVSEEFENLSKVHEQFPDKHLLFTEG
CIEGGVQLGAWGTGERYARNIIGDMNNWLEGFIDWNLVLNEQGGPNHVGNYCDAPIIADT
ERDVVHFNSSYYYIGHFSKYIRPGAKRVKVNSSAESLSLTAFKNNPNEIIVVLLNETEED
QSTKIEMQDYYSEVHLPKRSITTCIIER
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaagtttacagttatccaatcagataaagaatcagcttcatttttagaaaataaa
ggtgaaaaatccatattttcaaatgaaacgactacagcgagaaattcctatataacgatt
catgcagaagaagaatttcaggaatggatgggatttggcggggcattctctgaagcagcc
agttacactcttagtcagatttcccctcaaaaccgctccaaggtcattcagtcctatttt
gataagaaggaaggattggcctataatcttggaagaactcatatcaacagttgtgatttt
gccttagaaaattacacatatgtagaagagaacgatacaactcttgagtcctttaccatt
gatcgggagaaggaatgggtcctaccattgatccatgatgcgaaggagatagcaggtgaa
gagttgacgattttatcttcaccgtggagccctcccgcatggatgaaaaccaacaatgaa
atgaataatggtgggaagctaaaagaggaattccgacaactatgggctgattattatgct
gcctacattactgctatggaagagaatgatgtgaagatttggggggttaccgttcaaaat
gagccagcagtagcccaaacctgggattcgtgtgagtacacagctgaagaagaaagagat
tttgttaagaactatctcggcccaactttacaaagagcaggctatggagataaaaaaata
attatctgggatcataaccgtgacatgattgtggaaagagcttccgctgtactctctgat
ccagaagcggctcaatatgtttggggaactgggaaccactggtatgtatcagaagaattc
gagaacctttctaaagtacatgaacaatttcctgacaaacatttactgtttacagagggt
tgcattgaagggggagtacagctaggggcatggggaacaggtgaacgatatgcccgtaat
attatcggggatatgaacaactggcttgaagggtttattgattggaatttagtgctcaat
gaacagggtggacctaatcatgttggcaactactgcgatgctccaattattgcagatacg
gaaagagatgtcgtccattttaacagttcttattattacattggtcatttcagtaagtac
atacgacctggagccaaaagagtgaaagtaaattcctccgcggaaagcctttctttaaca
gcgtttaaaaataatccgaatgagatcattgtggttctcctgaatgaaacagaagaagat
caatccacaaagatagagatgcaagactattattctgaggttcacttaccaaaaagatcg
attacgacttgtattattgaaagataa

DBGET integrated database retrieval system