KEGG   Halobacillus halophilus: HBHAL_4421Help
Entry
HBHAL_4421        CDS       T02031                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hhd  Halobacillus halophilus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HBHAL_4421 (cysQ)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HBHAL_4421 (cysQ)
Transfer RNA biogenesis [BR:hhd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HBHAL_4421 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3343399..3344181)
Genome map
AA seq 260 aa AA seqDB search
MQKVVVQAAIEAGNEIMKIYETDFDVEYKEDESPLTIADQRSHEIIKAALQEHYPEIPIL
SEEGSQLSYDERKEWKQFWLVDPIDGTKEFIKKNGEFTVNIALIRDGKPVLGVVYAPALD
DLYVADEEKGAYKVTGVLSGGNVPANTTKLPLEDSNSKIAKVVASRSHMSKETEEFINQL
KESYEEVETISAGSSLKLCLVAEGKADYYPRYAPTMEWDTGAGQAVVELSGGRVEIANGK
TSLTYNKEILRNPWFLAHRS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtagttgttcaagcggcaatagaagcaggtaatgaaataatgaaaatctat
gaaaccgactttgatgtggaatataaggaagatgagtctccactaacaattgcggaccaa
cgttctcatgagattattaaggcagctctacaagagcactaccctgagattcctatctta
agtgaagagggttcacaactttcttatgacgaacgtaaagaatggaaacaattctggctg
gtcgatcccattgatggaacaaaagaatttatcaagaagaatggtgaattcaccgttaat
atcgcacttatcagagatggaaaaccggtacttggtgtggtgtatgctcctgcattagat
gatctttatgtagctgatgaagagaaaggcgcttataaagtgactggagtattatcgggc
ggtaatgtcccagctaacaccactaaactccctttagaagactcaaatagtaagattgca
aaagtagtagctagccgttctcatatgtctaaagaaacagaagaatttattaatcaatta
aaagagagctatgaagaagtggagacaatctctgcgggaagttctttgaaattatgcttg
gtcgctgaaggtaaagcggattattacccacgatatgcaccaaccatggaatgggataca
ggggcaggacaagccgttgtagaattatccggcggcagagtggaaattgctaatggaaag
acctcattgacttataataaagaaattctaagaaacccatggtttttagctcatagatca
taa

DBGET integrated database retrieval system