KEGG   Halobacillus halophilus: HBHAL_4500Help
Entry
HBHAL_4500        CDS       T02031                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhd  Halobacillus halophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBHAL_4500 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HBHAL_4500 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HBHAL_4500 (thrC2)
Enzymes [BR:hhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HBHAL_4500 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3437845..3438900
Genome map
AA seq 351 aa AA seqDB search
MWQGLLHHYREFLPVTDQTPNLSLQEGNTPLLSIPTISKEYGIEGYVKIEGANPTGSFKD
RGMVMAMAKAIEEGSKAVICASTGNTSASAAAFAARAGLRCIVVIPDGKIAQGKLAQAVM
YGAEIFSIKGNFDQALKMVREIAEKEPVTLVNSLNPYRIEGQKTGAFEVCDALGEAPDVL
SIPIGNAGNITAYWRGFQVYNEKYGHQLPRMMGFQASGAAAIVRNQVIEDPETLATAIRI
GNPASWEKAIQVKEESGGLIDEVTDDEIVEAYQLLAQKEGVFAEPASCASIAGMLKKVKS
GEIPQGSKVVHVLTGNGLKDPAAAIDTSPVKPTVIENDIDQFAEAISGVRS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaaggattgcttcaccattatcgtgaatttcttcccgtaaccgatcagacaccg
aatctgtctttacaggaaggcaatactcctcttttgtccataccgacgatttcgaaggag
tatggaattgaaggatatgtaaaaatcgaaggcgccaatccgaccggttcgtttaaggac
cgcggaatggtcatggcgatggctaaagcaattgaagaaggctcgaaagctgtcatctgc
gcatcaaccggcaatacgtcggcctctgcggcagcctttgccgcccgcgccggcctccgt
tgcattgtggtcatccctgatggcaaaatcgcccagggtaaactcgcccaggccgtcatg
tacggtgctgaaatcttttccattaaaggcaattttgatcaggcgttgaagatggtaaga
gaaatcgctgaaaaggaaccggtcacgctcgtaaactctttgaatccttatcggattgag
ggacagaaaaccggggcatttgaagtgtgcgacgccttaggtgaagcccctgatgtatta
tcgatcccgattggaaacgcaggcaatattaccgcctattggcgcggcttccaggtgtat
aacgaaaaatacggccatcagcttccgaggatgatgggctttcaagcaagcggtgcagca
gccattgtccggaatcaggttattgaagatccagaaacgcttgccactgccattcgaatt
ggaaatcctgcaagctgggaaaaagcgattcaggttaaagaagaatccggcggcttaatt
gacgaagtaacggatgacgaaattgtagaagcgtatcagcttctggctcaaaaagaagga
gtatttgctgaacctgcttcatgtgcgtcgattgcaggcatgcttaagaaagtaaagagc
ggcgaaataccacaaggatcaaaagtcgttcacgttctcaccggaaacgggctgaaggat
ccagcggccgcgattgatacaagtccggttaaacccacggtcattgaaaatgatatcgac
cagtttgccgaggccatctcaggagttcgctcatga

DBGET integrated database retrieval system