KEGG   Halobacillus halophilus: HBHAL_4531Help
Entry
HBHAL_4531        CDS       T02031                                 

Gene name
lacZ
Definition
(RefSeq) beta-galactosidase (EC:3.2.1.23)
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
hhd  Halobacillus halophilus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HBHAL_4531 (lacZ)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HBHAL_4531 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3464971..3466923)
Genome map
AA seq 650 aa AA seqDB search
MTYLGVDYYPEHWPKEMIDEDLQGIKELGANIVRIGEFAWHLMEPEEGQFDFSYFDHVLD
KVKEQGLNVMFGTPTATFPAWLAHKEPSVLSEDENGQTRVFGGRRQYCFNSDVYREYAGR
ITRKLVEHYSSEEAIISWQIDNEFGHEGSDMCYCDQCHSKFQQYLAEKYSSVEALNEEWG
TIFWGQTYNDFSEIPVPKPTVTTHNPSLKLEWARFRSFTVNSFTHEMTEIVREAKGSHQD
VTTNVSGGFFDKWFDHAENVKPMDYVSYDNYPVWGGLEKPVPPEAIAMTHDFNRGLKDQN
YWIVEELMGAQGHDVIGYLPRPNQAKMWSYQAFAHGCNNLLYFRWRGMTKGAEQFCYGVV
DHDNVYGRKYKEVQSLFTDIQQYERLLESRIESEAAVLYDYDNIWSWRSQIQSKDFDFNE
ELLRMYRPFYKRNIPIDVIPADRDFSQYKVVVVPVMQMMDESLAERLRSFAAGGGTVLFS
FRTGLKGKDNNLRLGEVLPGLVRDLTGVRVEEIESLTKEHAVELKGEGDFAQTSGTVSVW
RDLLVAETAEVLYHYQDQFYENYAAVTKNEVGKGSVYYIGGGLNEAPLDQMAEQILEERE
IEYIDSPEDVEVYRREVDDTSYLFVMNHSPYVKSFDGRQLQPYASEIIKK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacttaggtgtagattactatccggaacattggccaaaagaaatgatcgacgaa
gatcttcagggcatcaaagagcttggagcgaacatcgtaaggatcggcgagtttgcgtgg
cacttaatggagccggaagaagggcagtttgatttttcatatttcgatcatgttcttgat
aaagtgaaagagcagggactgaacgtgatgttcggcacgccaacggctacttttccagcc
tggcttgctcataaagaaccttctgttttatcagaagatgagaacggacagacccgcgta
ttcggcgggcgccgtcaatattgctttaactcggatgtttaccgggaatatgccgggagg
attacgcgtaagctggtcgagcattatagcagcgaagaagcgattatatcctggcagatc
gataatgaatttggccatgaaggcagtgatatgtgctactgtgaccagtgtcacagcaag
ttccagcagtacctggcagaaaaatattcatctgtcgaggctttgaatgaggaatggggc
acgattttctgggggcagacgtacaatgacttctcggaaattcctgtgccgaagccgact
gtgacaacccacaatccgagcctgaaattggaatgggcccgttttcgttcgtttacggtg
aacagctttactcatgaaatgacggagatcgtccgggaagcaaaaggcagtcatcaagac
gtcaccacaaacgtttctggtggatttttcgataaatggttcgaccatgcggaaaatgtg
aaaccgatggactatgtatcgtatgacaactacccggtctggggtggattggaaaaaccg
gtcccgccggaagcgattgcgatgacccacgactttaaccgtggcctcaaggatcagaac
tactggattgtggaagagctgatgggcgcgcagggacatgatgttattggttatctcccg
aggccgaatcaggcgaagatgtggtcgtaccaggcgtttgcgcatggctgcaacaacctg
ctgtatttccgctggcgcggcatgaccaaaggagcggagcaattctgttacggagtagtg
gatcatgataatgtgtacggccggaaatataaagaagtccagtcgttatttacggatatt
cagcagtatgaacgtttgctggaatcccgaattgaatctgaagcagcggtattatatgat
tacgataatatctggtcgtggaggtcgcagattcaaagtaaagattttgactttaacgaa
gagcttttgcgaatgtaccgcccgttttataagcggaatattccgattgatgtaatccct
gccgatcgtgatttttcacagtataaggtagtcgtggtacctgttatgcagatgatggac
gaatcgctggcagagcgtcttcgatcgtttgctgctggcggaggcaccgtcctgttctct
ttccggactggattaaaaggaaaagacaacaacctgaggcttggcgaagtgctcccagga
ttggtgcgcgacctgacgggtgtacgagtggaagaaatcgaatcactgacaaaagagcat
gccgtggagctgaaaggcgaaggtgactttgctcagacgagtggcacggtatctgtgtgg
agagatctgcttgtggcggaaacagcggaggtgctttaccattatcaggaccaattctat
gaaaactatgccgcagtaacgaagaatgaagtgggtaaaggaagcgtctattatatcggc
ggcggattaaatgaagctcctcttgatcagatggcagagcagattctggaagaacgggag
attgagtatatcgattctcctgaggatgtagaggtctatcgaagggaagtagatgatact
agctatctatttgttatgaaccacagtccctatgtgaaaagtttcgatggcaggcagctg
caaccttacgcaagcgaaataataaaaaagtaa

DBGET integrated database retrieval system