KEGG   Halobacillus halophilus: HBHAL_4542Help
Entry
HBHAL_4542        CDS       T02031                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hhd  Halobacillus halophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBHAL_4542
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBHAL_4542
   00052 Galactose metabolism
    HBHAL_4542
   00500 Starch and sucrose metabolism
    HBHAL_4542
   00520 Amino sugar and nucleotide sugar metabolism
    HBHAL_4542
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HBHAL_4542
   00524 Butirosin and neomycin biosynthesis
    HBHAL_4542
Enzymes [BR:hhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HBHAL_4542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3479183..3480076)
Genome map
AA seq 297 aa AA seqDB search
MGINIGIDLGGTNVRVAIVNKNGLVEELLQEPTEVEKGHLHTIKKMVNMIHTISEGKKRI
DGIGIGAPGPLDPKRGVILGPPNLPGWDEVYLVDEISQHFSANVYLTNDANAAALAEATY
GSGKGYESVYYVTVSTGVGGGLVTNGQVFHGAQGFAGEIGNMIVQRGGTQYSNLNKGALE
GYASGTAIGNRAKELHDIEGGAEAVFDLVREGNEEAWQIVDDAVDYLAVGIANVTHVVNP
DVFVIGGGVMNAGDLVWTPLREKVKGYVYEELVPHINLQPSSLSGDAGVIGASLLTR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgggaattaatataggaattgacttaggcggtaccaacgttcgtgttgctattgtaaat
aagaacgggctggtagaggaactgttacaagaaccgacagaagtagaaaaaggacatctt
cataccataaaaaaaatggtgaacatgatccacaccatttctgaaggaaagaaacgtatc
gacggaattggtattggagccccgggaccactcgacccgaagcgtggagtgattttaggt
ccaccgaatttaccgggctgggacgaagtttatctggttgatgaaatcagccagcatttc
tctgcaaacgtttatttaacgaacgatgcaaatgctgcggctcttgctgaagccacttac
ggcagcggaaagggctatgaaagtgtctactatgtaacggtaagcacaggggtaggcggc
ggtctggtgactaatggacaagtctttcatggggctcaagggttcgcaggtgaaatcgga
aatatgattgtccagcgcggtggtactcagtacagtaatttaaataaaggggcacttgaa
gggtacgcaagcggaacggcgattggaaatcgggcaaaggagcttcatgacatagaagga
ggagcggaagccgtattcgatcttgtcagagaaggaaatgaagaagcatggcagattgtc
gatgacgcggttgattatttagctgtaggcattgcaaatgtgacgcacgtcgtaaatcct
gatgtgtttgttattggcggtggggtgatgaacgccggtgatctggtgtggacacctctt
agagaaaaagtaaaaggatacgtctatgaagagctggttcctcatattaatctccagccg
tcttccctaagcggagatgccggcgtaataggagcctccctgctcacccggtaa

DBGET integrated database retrieval system