KEGG   Halobacillus halophilus: HBHAL_4869Help
Entry
HBHAL_4869        CDS       T02031                                 

Gene name
ybbD
Definition
family 3 glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hhd  Halobacillus halophilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HBHAL_4869 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HBHAL_4869 (ybbD)
Enzymes [BR:hhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HBHAL_4869 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3809648..3810886
Genome map
AA seq 412 aa AA seqDB search
MKRTLTAIGLTLVVVSAVILIINIRGGTQNAPKDASSHSKMPLRGNEEKSTRSPLLQWSM
EQKVSQTLYIGIQGLTLSNQEKEMISQNQVGGVILLGRNVESAPQLQNLVDSIRQANANN
PTPLFLGIDEEGGRVSRIPDSAIMNLPASKKIGDTMDPELAQKTGRLLAEKVKAFGFNMN
FAPVLDIVNNPNNQVIGDRSFGETPERVKNMGISAMQAIQSARVIPVVKHFPGHGNTSVD
SHYDLPVVDQTIEELEDFEWVPFKTAVEQGADAIMTAHILFPELDQKYPATLSKTIITGI
IREQLDFNGLVITDDMAMGAISNNYGTSEAAVLSIQAGADMVLLTDTSQFQSVKNSLIQA
VRDGQIPESQLNTSVTRILQKKETYKLSEPYEDTAEISQLNMQIEEVWNQIQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgcacccttacagctattggactaacgcttgttgtcgtgtcggctgtcattcta
ataatcaacatcagaggtggcactcagaacgcgccaaaagatgcatcctcccattccaaa
atgccactaagagggaacgaagagaaaagtacccgctcccctctcttacagtggtctatg
gaacaaaaagtctcccaaaccttatatattggtatccagggacttactttaagtaatcag
gagaaagaaatgatcagccagaatcaggttggaggggtaattttactcgggcgaaatgtt
gagagcgccccacagctgcagaatttagtggattcgattcgccaggcaaatgcaaataat
cccaccccactttttttagggattgatgaggaaggcggccgggtaagccggattccggac
agtgccatcatgaatcttcctgccagcaaaaaaattggcgacacaatggatccagagctt
gctcaaaaaacaggacgactattggctgaaaaagtgaaagcatttggctttaatatgaac
tttgcgcctgtgcttgatatcgtaaataatccaaataatcaagtgattggagatcgttcc
ttcggagaaactccagagcgcgttaaaaacatggggatctcagccatgcaagccatacaa
tcggctcgggtcatacccgtggtcaaacacttcccaggtcacggaaatacgtctgtggat
tcacactatgaccttcctgtcgtggatcaaaccatagaagagttagaggatttcgaatgg
gtaccttttaagacggctgttgaacaaggggcagatgccatcatgaccgctcacatctta
ttccctgaactcgatcagaaataccctgccactctttctaaaacaattattacaggtatt
atccgagagcagctggatttcaacgggcttgtcattacggacgatatggctatgggagca
atctccaataattatggaacaagcgaagcagccgtactctcgatacaagcaggggcggat
atggttttattaacagatacaagtcagtttcagagtgtgaaaaattcgcttatccaagct
gttagggacggacaaattccagaaagtcagttaaataccagtgttacaagaatacttcag
aaaaaggaaacttataagttaagtgaaccgtatgaggacaccgcagaaatctctcaactc
aatatgcaaattgaagaggtatggaatcagattcaataa

DBGET integrated database retrieval system