KEGG   Halobacillus halophilus: HBHAL_4869Help
Entry
HBHAL_4869        CDS       T02031                                 

Gene name
ybbD
Definition
family 3 glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hhd  Halobacillus halophilus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hhd00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:hhd00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3809648..3810886
Genome map
AA seq 412 aa AA seqDB search
MKRTLTAIGLTLVVVSAVILIINIRGGTQNAPKDASSHSKMPLRGNEEKSTRSPLLQWSM
EQKVSQTLYIGIQGLTLSNQEKEMISQNQVGGVILLGRNVESAPQLQNLVDSIRQANANN
PTPLFLGIDEEGGRVSRIPDSAIMNLPASKKIGDTMDPELAQKTGRLLAEKVKAFGFNMN
FAPVLDIVNNPNNQVIGDRSFGETPERVKNMGISAMQAIQSARVIPVVKHFPGHGNTSVD
SHYDLPVVDQTIEELEDFEWVPFKTAVEQGADAIMTAHILFPELDQKYPATLSKTIITGI
IREQLDFNGLVITDDMAMGAISNNYGTSEAAVLSIQAGADMVLLTDTSQFQSVKNSLIQA
VRDGQIPESQLNTSVTRILQKKETYKLSEPYEDTAEISQLNMQIEEVWNQIQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgcacccttacagctattggactaacgcttgttgtcgtgtcggctgtcattcta
ataatcaacatcagaggtggcactcagaacgcgccaaaagatgcatcctcccattccaaa
atgccactaagagggaacgaagagaaaagtacccgctcccctctcttacagtggtctatg
gaacaaaaagtctcccaaaccttatatattggtatccagggacttactttaagtaatcag
gagaaagaaatgatcagccagaatcaggttggaggggtaattttactcgggcgaaatgtt
gagagcgccccacagctgcagaatttagtggattcgattcgccaggcaaatgcaaataat
cccaccccactttttttagggattgatgaggaaggcggccgggtaagccggattccggac
agtgccatcatgaatcttcctgccagcaaaaaaattggcgacacaatggatccagagctt
gctcaaaaaacaggacgactattggctgaaaaagtgaaagcatttggctttaatatgaac
tttgcgcctgtgcttgatatcgtaaataatccaaataatcaagtgattggagatcgttcc
ttcggagaaactccagagcgcgttaaaaacatggggatctcagccatgcaagccatacaa
tcggctcgggtcatacccgtggtcaaacacttcccaggtcacggaaatacgtctgtggat
tcacactatgaccttcctgtcgtggatcaaaccatagaagagttagaggatttcgaatgg
gtaccttttaagacggctgttgaacaaggggcagatgccatcatgaccgctcacatctta
ttccctgaactcgatcagaaataccctgccactctttctaaaacaattattacaggtatt
atccgagagcagctggatttcaacgggcttgtcattacggacgatatggctatgggagca
atctccaataattatggaacaagcgaagcagccgtactctcgatacaagcaggggcggat
atggttttattaacagatacaagtcagtttcagagtgtgaaaaattcgcttatccaagct
gttagggacggacaaattccagaaagtcagttaaataccagtgttacaagaatacttcag
aaaaaggaaacttataagttaagtgaaccgtatgaggacaccgcagaaatctctcaactc
aatatgcaaattgaagaggtatggaatcagattcaataa

DBGET integrated database retrieval system