KEGG   Halobacillus halophilus: HBHAL_4993Help
Entry
HBHAL_4993        CDS       T02031                                 

Gene name
glgB
Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hhd  Halobacillus halophilus
Pathway
hhd00500  Starch and sucrose metabolism
hhd01100  Metabolic pathways
hhd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HBHAL_4993 (glgB)
Enzymes [BR:hhd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HBHAL_4993 (glgB)
Exosome [BR:hhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HBHAL_4993 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CCG47330
UniProt: I0JT58
Position
complement(3952557..3954476)
Genome map
AA seq 639 aa AA seqDB search
MANESTLEHDIYLFHEGNLRYSYRLLGAHPDVQDGVEGIRFAVWAPNAVQVSVVGIFNEW
DGRQNPMEKVNDNGIWMAFIPNLEKGTIYKYEILTAHGHLRLKADPYAFSSELRPDTASV
VYPLDNYTWNDDEWMKERKAQNIYESPVSIYELHLGSWKYIEPEVYYNYREYADMVIPYV
KDLGYTHIELLPIMEHPFDRSWGYQTTGYFGVTSRYGSPDDFKYFVDQCHQHGLGVILDW
VPGHFCKDEHGLRRFDGEALYEYQNPSKAEKTQWGTLTFDFGRSEVHSFLISNAIYWLKE
YHLDGLRVDAVASMLYLDFGKNEGEWELNEYGGRENIEAVSFIKKMNEAVFEEVPDTLMM
AEESTSWPLVSSPTYIGGLGFNYKWNMGWMNDMLKYMETDPIHRKYNHNLITFSLFYAFS
ENFVLPISHDEVVHGKKSLLNKMPGDYWQKFANLRAFLGYMYAHPGKKLLFMGGEFGQFD
EWKDLEDLDWELLEYDSHAATKNYMKELHQLYLDSAPLWELDHKEEGFSWIDAQNYDQSI
VSFARNSRTSNDQLIVVCNFTPQVYHDYKVGVPKHGSYKEIFSSDAERFGGSGQVNGGPL
GTIPEPWQGQDQHITMTIPPLGVSFLKRTSVSKEENHEK
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtggccaatgaatcaacgttagaacacgatatctacttatttcatgaaggaaatctccgg
tatagttaccggcttcttggggctcacccggatgttcaggacggagtagaaggtattcgt
tttgcagtctgggcgcccaatgctgtacaagtaagtgtggtaggtatatttaatgaatgg
gacggaagacagaatcctatggagaaagtgaacgataatgggatatggatggcctttatt
ccgaaccttgaaaaaggcaccatctataaatatgaaattttgacggctcatggacatctt
cgtttaaaagctgacccttacgctttttccagcgaattgcgccccgatacggcttccgtt
gtttatcctcttgataactatacatggaatgatgatgaatggatgaaggaacgaaaagct
caaaatatctatgaatctcctgtatccatctatgagcttcatttaggttcatggaagtat
attgaacctgaagtttactacaattatcgtgaatatgcagatatggttattccttatgtt
aaggatctcggctatacacatatcgaactccttccaattatggaacacccttttgaccgt
tcctggggctatcagaccactggttactttggtgtgacatcacgctacggatcacccgat
gacttcaaatatttcgtcgatcaatgtcaccagcatgggctcggagtcattctggactgg
gtacccggccacttttgtaaagacgaacacgggttaagacgttttgacggggaagccctc
tatgaatatcagaacccgagcaaagcggagaagacgcagtggggtacgttaacctttgat
tttggaagaagtgaagtacacagcttcttaatatccaatgcgatttactggctgaaggaa
taccatctggatggtctgcgtgtcgatgctgtagcaagcatgctgtatttagactttggc
aagaacgaaggggaatgggagctgaatgaatatggaggccgtgaaaatatcgaagcggtt
tctttcattaagaagatgaatgaggctgtatttgaagaagttccagatacactcatgatg
gcagaagagtcgacttcatggccattagtcagttctcccacttatatcgggggactcggc
tttaactataaatggaatatgggctggatgaatgacatgctaaaatacatggagacggat
cccatccatcgtaagtacaaccataatctcattacattctcattgttctatgctttctca
gaaaacttcgtacttccgatttcccatgatgaagttgtccatggaaagaaatcgttacta
aataagatgccgggcgactattggcagaaattcgcaaacttaagagcctttttagggtac
atgtatgcccaccctggtaagaagttattattcatgggaggtgagtttggtcagttcgat
gaatggaaagaccttgaagatcttgattgggagctcctggagtatgactcccatgctgcc
accaagaattacatgaaagagcttcaccaactctatctggactcggctcctttatgggaa
cttgatcacaaagaagaagggttttcatggattgatgcccagaattacgatcaaagcatt
gtatcattcgcaaggaacagccgtacatcaaacgatcaattaatcgtggtatgcaatttc
actcctcaggtttatcacgattacaaagtaggagtaccgaaacatggctcatacaaagaa
atcttctcgagtgatgcggaacgcttcggaggttcagggcaggtcaatggagggccgctc
ggaacaattcctgaaccctggcaaggccaggatcagcatatcaccatgaccattccaccg
ctcggtgtgagcttcttgaagagaacttcagtatccaaggaggaaaatcatgaaaaataa

DBGET integrated database retrieval system