KEGG   Helicobacter hepaticus: HH0524Help
Entry
HH0524            CDS       T00133                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hhe  Helicobacter hepaticus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HH0524 (dxr)
Enzymes [BR:hhe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HH0524 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
505702..506811
Genome map
AA seq 369 aa AA seqDB search
MILLGSTGSIGTNALEVASHFDIPIESLCAGKNITLLNQQIAHYAPKNVCIADKNDAHKL
INGNYKLFFGSEGILEMIESSHSHLLLNALVGFAGLKPSFKALQCNKKLALANKESLVNA
GWLLQNADITPIDSEHFGLWYLQNNRPITKLYITASGGAFRDYPLDKIALATPQEALKHP
NWQMGYKITIDSASMANKLFEILEARWLFDIESIDAFIEPSSSMHALIEFADGSITTHIS
TPDMKLPIAYALDKDKAAQMPFIQPLDIQSLCLALKNIDTLRYPLWNLKDTLLHTPQKGI
VLNASNEIAIEAFLAQKIPFGHISALILAMMEYFDSFKFASLCDLESIQAFDNQVRAVSS
QWLERKIKE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattttacttggtagcacagggagcattggcacaaacgcccttgaagttgcctcacat
tttgatatacccatagaatctctgtgtgctgggaaaaatatcacgcttttaaatcaacaa
atcgcacactatgcgccaaaaaatgtttgtattgctgataaaaatgacgcccataaactc
ataaatggcaactataagctgttttttgggagtgagggcatactagaaatgatagaatcc
tctcattctcatctactgctgaatgcccttgtaggatttgctggattaaaacctagcttt
aaagccttgcaatgtaacaaaaaactcgctcttgcaaataaagaatccctagtaaatgct
ggctggctcttgcaaaatgcagatattactcccattgatagcgaacattttggcttatgg
tatttacaaaacaatcgcccaataactaaactttatattactgcaagcggtggagctttt
agggattatccactagataaaatcgcccttgctaccccacaagaagcacttaaacaccca
aattggcaaatgggatataaaatcaccatagattctgcaagtatggcaaataaacttttt
gaaatacttgaagcgcgttggctcttcgatatagaatctattgatgcctttattgagcca
agctcaagtatgcacgcacttattgaatttgcagatgggagcattacaacacatataagc
acgcctgatatgaagctccctattgcctatgcacttgataaagataaggcagcacaaatg
ccttttatccagcctttggatatacaatccctctgccttgctcttaaaaacattgatacg
cttcgttatccgctatggaatcttaaagacacgcttttacatacaccacaaaaaggcatt
gtgctaaatgcaagcaatgaaatagccatagaagcgttcttagcacaaaaaatacctttt
ggacatataagtgcgcttattttggcgatgatggaatattttgatagctttaagtttgct
tctttgtgtgatttagaatccatacaagcctttgataaccaagtgcgtgcagtctcatca
caatggttagagagaaaaattaaagaataa

DBGET integrated database retrieval system