KEGG   Helicobacter hepaticus: HH0527Help
Entry
HH0527            CDS       T00133                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hhe  Helicobacter hepaticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HH0527 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HH0527 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HH0527 (thrC)
Enzymes [BR:hhe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HH0527 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
507717..509261
Genome map
AA seq 514 aa AA seqDB search
MNTYDENLLYSTRDDTAFGVSFQHALLHPNAQHNGLYTFTKLPHISLEDIENFTNLTYTK
LCVDIFNRLKLGIHRSVLEEALLSYKNFDDSYNPAPLKVVNENLFMLNLFSGPTRAFKDM
ALQPFGRLFAHLATQDTRPYLILTATSGDTGPATLQSFANQPHIRVVCIYPYGGTSDVQR
LQMTTHTAPNVKVIGIEGDFDGAQSALKKLIANVDFVKKLKEQGFALSAANSVNIGRIAF
QIIYYFWAYVKLLKDGHITLGEKISVVVPSGNFGNILGAFFAKKMGLPLERLVSASNANN
ILSDFINTGVYDISKRNLIKTKSPAMDILKSSNVERVLYALFGAQRTKQLMDSLDKKDFY
SLTAEELSLLQQDFSAFECDDKMCMQSIAQGFKEGLLLDPHSAIAYFVAKNLQKSSVIGK
SVFLATAEWSKFAPSVREALKEADIIKNTQEAYEISDKQAIDEICSLSCANNPIKAPEQI
LQLFSKKEVQQDIIPIPQLEMCIMRWVRCSLKHS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatatgatgagaatctcttatattccacgcgagatgatacagcctttggcgta
agctttcaacacgctttattacacccgaatgcacaacataatgggctttatacctttacc
aaactccctcatatcagcctagaggacattgaaaattttacaaaccttacttataccaag
ctgtgcgtagatatttttaatcgcttaaaacttggaatccatagaagtgtgcttgaagaa
gcacttttaagctataaaaattttgatgattcttataatcctgctccacttaaagtggta
aatgagaatctctttatgcttaatctcttctctggtcctacgcgtgcttttaaagatatg
gcacttcaaccctttggacgtttgtttgcacatcttgctacgcaagatacaagaccctat
cttattctcactgccacaagcggtgataccggacctgcaaccttgcagagctttgcaaat
caacctcatatcagggttgtgtgcatttatccttatggaggcactagcgatgtgcagcga
ttacaaatgacaactcataccgcaccaaatgtaaaagttattggtattgagggggatttt
gatggagcgcaaagtgcattaaaaaaacttatcgcaaatgtagattttgtaaaaaaactc
aaagagcaaggatttgcgctctctgctgcaaattctgtgaatattggacgcattgcattt
caaatcatttattatttttgggcgtatgtaaaattacttaaagatggacatattacactt
ggggaaaagatctctgttgtcgtgccaagtggcaactttggcaatattttaggagcgttt
tttgcaaaaaaaatgggtttaccccttgagcgtcttgtgagcgcttctaatgcaaataat
atcttaagtgattttataaacacgggtgtatatgatatttctaagcgaaacttaattaaa
accaaatcccctgctatggatattttaaaaagttcaaatgtagagagagtgctttatgca
ctctttggcgcacaacgcacaaagcaattaatggatagccttgataaaaaagatttttat
agcctcactgctgaagagttaagcttacttcagcaagattttagtgcatttgaatgtgat
gataaaatgtgtatgcagagcattgcgcaaggattcaaagaaggattactacttgacccg
catagtgcgattgcttattttgtagcaaaaaatttgcaaaaaagtagtgtaattggcaaa
agtgtatttcttgccacagcagaatggagtaaattcgccccaagtgtgagagaagcactc
aaagaagcagacatcattaaaaacacacaagaagcttatgaaataagcgataaacaagcc
attgatgagatttgctcactctcttgtgccaataatcctatcaaagcacccgagcagatt
ctccaactttttagcaaaaaagaagtgcagcaagacattatccctattccacagctagag
atgtgtataatgcgatgggtgagatgttctctcaagcattcttaa

DBGET integrated database retrieval system