KEGG   Helicobacter hepaticus: HH0546Help
Entry
HH0546            CDS       T00133                                 

Gene name
porB
Definition
ferrodoxin oxidoreductase beta subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hhe  Helicobacter hepaticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HH0546 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HH0546 (porB)
   00020 Citrate cycle (TCA cycle)
    HH0546 (porB)
   00620 Pyruvate metabolism
    HH0546 (porB)
   00640 Propanoate metabolism
    HH0546 (porB)
   00650 Butanoate metabolism
    HH0546 (porB)
  Energy metabolism
   00680 Methane metabolism
    HH0546 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HH0546 (porB)
Enzymes [BR:hhe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HH0546 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(525972..526919)
Genome map
AA seq 315 aa AA seqDB search
MVKEVKNLKEFQKSSKKFEGAHLLCPGCAHGMIVREVLSAVDGPIILGNSTGCLEVSSAV
YPHTSWDVPWIHIGFENGSTAVAGAEAMYKALVRKGRYTGEKPKFVAFGGDGATYDIGFQ
WISGCFERGHDMTYICLDNEVYANTGGQRSGSTPLGSSTSTTPAGSASYGKKERKKDLLF
IMAAHHAPYVAQVAPNKWKDMNKKIKRAIDTEGPTFINAMSACTTEWRFESNKTVEISDL
AVDSLVFPLFEIINGVELHITYRPRNVVPVRDYLGAQGRFKHLFKPENEHIIKQFQKDVE
ARWEYLQRREEINPK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagttaaaaatcttaaagagtttcaaaaatcatcaaagaaatttgaaggt
gcgcatttactttgcccaggttgtgcgcacggaatgattgtgcgtgaagtattaagtgcg
gttgatggacctattattttaggaaattcgacaggttgccttgaggtttcaagcgcagta
tatccgcatacaagctgggacgtgccttggatacatattggtttcgaaaatggttctact
gctgtggctggtgcagaagctatgtataaagcacttgtacgtaaaggcagatacacaggc
gaaaaacctaaatttgttgcatttggtggtgatggcgcgacttatgatattggattccaa
tggattagcgggtgctttgagcgcggacacgatatgacttatatttgtcttgataatgaa
gtgtatgcaaacacaggtgggcagagaagtggctctacaccgctgggttctagcacttca
acaactcctgcaggaagtgcaagctatggtaaaaaagagcgcaaaaaagatttactcttt
ataatggcagcacatcacgctccttatgtcgctcaagtcgctccaaataaatggaaagat
atgaacaaaaaaattaaacgtgccattgatacagagggaccgacatttattaatgcaatg
agtgcttgcacaacagaatggcgatttgaatctaacaaaaccgttgaaatcagtgattta
gctgtggattctcttgtgtttccattgtttgaaattattaatggcgtagaattgcacatt
acttatcgcccacgtaatgttgttccagtgcgcgattatttaggtgcacaagggcgtttc
aagcatctttttaaacctgaaaatgagcatattattaaacaattccaaaaagatgtggaa
gcacgttgggaatatctccaacgtagagaagaaattaatcctaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system