KEGG   Helicobacter hepaticus: HH0547Help
Entry
HH0547            CDS       T00133                                 

Gene name
porA
Definition
pyruvate flavodoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hhe  Helicobacter hepaticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HH0547 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HH0547 (porA)
   00020 Citrate cycle (TCA cycle)
    HH0547 (porA)
   00620 Pyruvate metabolism
    HH0547 (porA)
   00640 Propanoate metabolism
    HH0547 (porA)
   00650 Butanoate metabolism
    HH0547 (porA)
  Energy metabolism
   00680 Methane metabolism
    HH0547 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HH0547 (porA)
Enzymes [BR:hhe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HH0547 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(526930..528150)
Genome map
AA seq 406 aa AA seqDB search
MAKTMELRTIEVWDGNMAASQALRQAQIDVVAAYPITPSTPIVQNYGSFVSNGYIDGEFV
MVESEHAAMSACVGAAAAGGRVATATSSQGFALMVEVLYQASGMRLPIVLNLVNRALAAP
LNVNGDHSDMYLSRDTGWINLATYNPQEAYDFNLMAFKIAEDKRVRVPVIVNQDGFICSH
TAQSVRPFTDEEAYKFIGDYIPHNPMLDFANPITYGAQTEEDWHFEHKAQLHKGIMDSAA
VIEEVFESFAKVSGRKYNLVETYMCEDAEVAIVALGTSVESARVAAKKVREEKGIKAGVL
SIRTLRPFPFKQIGEALKSLKAVACLDRSLPAGALGMLFNEFSAAALSAGAHPVMSNYIY
GLGGRDLTQAHLEGIFNELDANVKAGKLTHPVQQMLGLRGPKMSFF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaacaatggaattacgaacgattgaggtgtgggacgggaatatggcagcctct
caagcactgcgtcaagcacaaattgatgtggtagcagcttatcctattacaccttcaact
ccgattgtgcaaaattatggaagttttgtgagtaatggttatattgatggtgagtttgtt
atggtggaatctgaacacgctgctatgagtgcgtgtgtaggtgcagctgcagctggagga
agagtagcaactgcgacaagctctcaaggttttgctcttatggtagaggtgctttatcag
gcttctggtatgcgcttacctattgttttaaatcttgtcaatcgtgcgcttgctgcgccg
cttaatgtcaatggtgaccattctgatatgtatcttagccgcgatacaggttggataaat
cttgctacctataatccccaagaagcatatgattttaatcttatggcatttaagattgca
gaagataaacgcgtgagagtgcccgtaattgtgaatcaagatggttttatttgctctcat
acagcccaatcagtgcgtccatttactgatgaagaggcatataagtttattggcgattat
atcccacataatcctatgcttgattttgctaatcctatcacttatggagcgcagacagag
gaagattggcattttgagcataaggcacaattacataagggcattatggattcggctgca
gtgatagaggaagtatttgaatcttttgcaaaagtgtcgggacgcaaatataatcttgtt
gagacctatatgtgtgaagatgcggaggtagcaattgttgcacttggcacaagtgtagaa
tctgctcgcgtggcagctaaaaaagtgcgtgaggaaaagggaattaaagcaggagtgctt
tcaatccgcactttgcgtccttttccttttaagcaaataggagaagcactcaaatctctt
aaggctgtagcgtgtttagatagaagtcttcctgctggtgcgcttggtatgctatttaac
gaattttctgctgcggctttatctgctggtgcgcaccctgtgatgtcaaattatatctat
ggacttggcggacgtgatttgactcaggcacatttggaaggtatttttaatgagcttgat
gcaaatgtaaaagctggcaaacttacacacccagttcaacaaatgttagggcttcgcgga
cctaaaatgagctttttttaa

DBGET integrated database retrieval system