KEGG   Helicobacter hepaticus: HH0578Help
Entry
HH0578            CDS       T00133                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hhe  Helicobacter hepaticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HH0578 (galU)
   00052 Galactose metabolism
    HH0578 (galU)
   00500 Starch and sucrose metabolism
    HH0578 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HH0578 (galU)
Enzymes [BR:hhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HH0578 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(555263..556015)
Genome map
AA seq 250 aa AA seqDB search
MLPILTKPLIQYGVEEALESGCCNIGIVTGRGKRAIEDYFDVSYELEHQISGTDKEELLN
EIRNLTDTCTFSYTRQIAMKGLGDAILKGKNLIGKEAFAVILADDLCINPQGKGVLAQMV
ELYKKYQCCIVAIEEVKRSDVDKYGIIEGEEIESGVYEVSNMIEKPSIDKAPSNFAIIGR
YILTPDIFDILAVTKPGKKGEVQITDALLEQSKKGRVLAYKFQGKRYDCGSIDGYVKATI
DFYQALNANV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgttacccatactcacaaagccacttattcagtatggtgtagaagaagctctagaatct
ggttgttgtaacataggtattgttacaggaagaggtaagcgtgctattgaagattatttt
gatgtgagttatgagttagaacatcaaatatcaggcacagataaggaggaattattaaat
gagattcgcaatctcacagatacttgcacattttcttatacgcgccaaattgcaatgaaa
ggattaggagatgctattttaaaaggcaaaaatctcattgggaaagaagcctttgcggtc
attctcgctgatgatttatgtattaacccacaaggtaaaggcgtgcttgctcaaatggta
gagttgtataaaaaatatcaatgctgcattgtcgctattgaagaagtcaaaagaagtgat
gtggataaatatggcattattgagggagaggagatagaatctggtgtatatgaggtgagt
aatatgatagaaaagccaagcatagataaagctccaagcaattttgccattattgggcgc
tatattcttacacctgatatttttgacattctagcagttacaaaaccgggaaaaaaggga
gaagttcaaatcactgatgcacttttagagcaaagtaaaaagggacgcgtattagcatat
aagtttcaaggcaaacgttatgattgcgggagtattgatggctatgttaaagcaactata
gatttttatcaggctttaaacgcaaatgtttaa

DBGET integrated database retrieval system