KEGG   Helicobacter hepaticus: HH0613Help
Entry
HH0613            CDS       T00133                                 

Gene name
glmM_1
Definition
phosphohexosemutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hhe  Helicobacter hepaticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HH0613 (glmM_1)
   00030 Pentose phosphate pathway
    HH0613 (glmM_1)
   00051 Fructose and mannose metabolism
    HH0613 (glmM_1)
   00052 Galactose metabolism
    HH0613 (glmM_1)
   00500 Starch and sucrose metabolism
    HH0613 (glmM_1)
   00520 Amino sugar and nucleotide sugar metabolism
    HH0613 (glmM_1)
  Nucleotide metabolism
   00230 Purine metabolism
    HH0613 (glmM_1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HH0613 (glmM_1)
Enzymes [BR:hhe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HH0613 (glmM_1)
    5.4.2.8  phosphomannomutase
     HH0613 (glmM_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592187..593635
Genome map
AA seq 482 aa AA seqDB search
MQTLHNKHILEITHIFREYDIRGIFGDDLTHEVVCGIGQLLGEYIIESKLPPCIYIGYDA
RTHSPTLLTWLAEGFASTGIEVYDLGLIPTPVAYFATFNTIDSITCPHSVMITGSHNPPQ
YNGFKITINQTPFYGEQIRALGTKLTTLLNQQNKHNILPNTHQNKTYTKINALGAYIDYL
TRAFASLENFPYLIAVDCGNGVGGIGIKKILENLNINYTPLFFEPDGTFPNHHPDPSEEK
NLIALKDKMKSDSIPIGIAFDGDADRLALLTTHYNYKGDELAILFAQEMKRRFLSPVVIG
EVKCSQVMYDEINKIGKAIMYKTGHSNLKVKLKELNAHLAAEMSGHLFFNDRYFGYDDAI
YASLRALELFLHYTPKELEATINALPHLYSTDEEKISTTEEEKFTLIHTLGEALKNPPAD
FPSIKDIISIDGLRVIFENGWGLIRASNTTPVLVTRFEAISKEECESYKTHLLALLKNCQ
KT
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacactacacaataaacatattttagaaattacacatatttttcgcgaatatgat
attcgtggtattttcggtgatgacctcacgcacgaagttgtatgtggcatagggcaacta
cttggagaatatattatagaatctaaactgcctccttgcatatatattggctatgatgca
cgcacacattcgcctactcttcttacgtggcttgcggaaggttttgcatcaacaggtatt
gaagtttatgatcttggacttatccctactcctgtggcatactttgcaacctttaacacc
atagattctatcacttgtcctcattctgtaatgattacaggctcacacaatccgcctcaa
tacaatggctttaaaattaccattaatcaaacacctttttatggagagcaaatccgtgct
cttgggacaaaactcactacgttgctcaatcaacaaaataaacacaatattctcccaaat
acacatcaaaataaaacatatacaaaaattaacgctcttggggcatatatagattatttg
acgcgagcatttgcctcccttgagaattttccctatcttattgctgtagattgtggcaac
ggcgtgggtggtataggtataaaaaaaattttagaaaatcttaatattaactatacacca
cttttttttgaaccagatggcacttttcccaatcatcacccagacccaagcgaggaaaaa
aatctcattgcacttaaagacaaaatgaaatcggattctataccgattggaattgccttt
gatggagatgctgatagacttgcacttttaacaactcattataattataaaggcgatgaa
cttgctattctttttgcgcaagagatgaaaagacgctttttaagtcctgtcgtcattggc
gaagtcaaatgttcgcaagtgatgtatgacgaaatcaacaaaatcggcaaagcaataatg
tataaaacaggacatagtaaccttaaagtcaagcttaaagagctcaatgcacatcttgca
gcagaaatgagtgggcatctcttctttaatgaccgatattttggctatgatgatgcaatt
tatgcttcacttagagctttagagttgtttttgcactatacaccaaaggaactagaagct
actatcaatgctctacctcatctttacagcacagacgaagagaagatttctaccacagag
gaagagaaattcactcttattcacacccttggtgaggcattaaaaaaccctcctgctgat
ttcccttccattaaagatattatcagcattgatggattgcgtgtaatatttgaaaatggc
tggggactcataagggcaagtaatactacacctgtgcttgttacacgttttgaagctata
agcaaagaagaatgcgaatcttataaaactcatttacttgctcttctgaaaaattgtcaa
aaaacataa

DBGET integrated database retrieval system