KEGG   Helicobacter hepaticus: HH0667Help
Entry
HH0667            CDS       T00133                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hhe  Helicobacter hepaticus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HH0667
Enzymes [BR:hhe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HH0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645722..646345
Genome map
AA seq 207 aa AA seqDB search
MNIHTTQVSPELIASIASISLSMFRKNFFGVFHGAISARVAKNRFIINKQQAIFDNLNAN
SMIALYHRQDYRWDEASLHAPIHASIYEHFSEAKFIAYAMPPYLVSYSLKYNALKPQDYF
GYKFLAPCIEIFDPKDYETWEKRADTDIPRYFKEHNHSFMLIKGYGVYAYARDIYTLAKV
IALIENSCKILHYNASLHERCQDKSQI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacataccactcaagttagcccagaacttattgcaagtattgctagtatttcg
ctttctatgtttagaaagaatttctttggtgtatttcacggagcaatttctgcgcgtgtg
gcaaaaaatcgctttattatcaacaaacaacaagctatttttgataacctcaatgcgaat
tctatgattgcactttatcatagacaagattatcgctgggacgaagctagcttacacgct
cctatacacgcaagtatttatgagcatttctctgaagcaaaattcattgcttatgctatg
ccaccctatcttgtttcctactctctcaaatataatgcccttaaacctcaagattatttt
ggctacaaatttctcgccccctgcattgaaatttttgaccccaaagattatgaaacttgg
gaaaaacgagcagatactgatattccacgatattttaaagaacacaatcattcttttatg
ttaattaaaggctatggtgtatatgcctatgctcgtgacatttacacacttgctaaagta
attgctcttattgaaaattcgtgtaaaatcttacattataatgcaagtttgcacgaaaga
tgtcaagataaatcccaaatataa

DBGET integrated database retrieval system