KEGG   Helicobacter hepaticus: HH1315Help
Entry
HH1315            CDS       T00133                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hhe  Helicobacter hepaticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HH1315 (tpiA)
   01230 Biosynthesis of amino acids
    HH1315 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HH1315 (tpiA)
   00051 Fructose and mannose metabolism
    HH1315 (tpiA)
   00562 Inositol phosphate metabolism
    HH1315 (tpiA)
Enzymes [BR:hhe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HH1315 (tpiA)
Exosome [BR:hhe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HH1315 (tpiA)
  Exosomal proteins of bladder cancer cells
   HH1315 (tpiA)
  Exosomal proteins of melanoma cells
   HH1315 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1273743..1274450)
Genome map
AA seq 235 aa AA seqDB search
MTIIAGNFKANLTRIQVATFAKELDSILTDMQTSSHLQVDIFPSHTALLTNNFKHFHIGA
QNAYFAQNGGFTGEIGLSQLQEFNINRLIIGHSERRTLFGENQDFINKKFRFYAEAGFEI
YYCIGEPLSMRQKGKNALKDFLGAQLDGIDITYPKLIIAYEPIWAIGTGESATLEQIEST
HSMLATFTSAPLLYGGSVNPTNAREILCTPYVNGVLVGSASLNIQSFTDIIRASK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactatcattgctggtaatttcaaggcaaatctcacacgcattcaagttgctaccttt
gcaaaagagctagattctatactcacagatatgcaaacatcatctcatcttcaagtagat
atttttccttctcatacggcattacttacgaataattttaagcattttcatatcggcgca
caaaatgcgtattttgcacaaaatgggggattcacgggcgagattggactaagccaactc
caagaatttaatattaatcgccttattattgggcatagcgaacgtaggacactttttggt
gaaaatcaagattttattaataaaaaatttagattctatgcagaagcaggatttgaaata
tattactgcattggtgagcccttgagtatgcgacaaaagggtaaaaatgcgctcaaagac
tttctaggtgcacaattagatggtattgacatcacttatcctaagcttattattgcatat
gaacctatttgggctattggcacaggtgaaagtgcgactttagaacaaatagaatctact
cactcgatgcttgctacatttacaagtgccccgctactttatggaggcagtgtgaatccc
acaaatgcaagagagattctttgcactccttacgtaaatggtgtgcttgtaggctctgca
agcctcaatatacaaagctttacggatattattcgtgctagtaaatag

DBGET integrated database retrieval system