KEGG   Helicobacter hepaticus: HH1316Help
Entry
HH1316            CDS       T00133                                 

Gene name
yhjA
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hhe  Helicobacter hepaticus
Brite
Enzymes [BR:hhe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HH1316 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274627..1275688
Genome map
AA seq 353 aa AA seqDB search
MKTYLGVLLAFSVMLQANDMVYDSALIKKAKEAGLVSMPSGKKLKDIQIQKAKESKLAEA
YPNKMTKEQIELGKKLYFDPRISSSNLISCNTCHNVGLAGVDIVPAAIGHKWTHNPSHLN
SPTVYNSVFNSAQFWDGRSAHLGDQAQGPIQAAPEMNAQPKVVVAKITSIPAYVEEFKKA
YGKDVKIDFKLIADTIAMFEHTLVTPARIDKFLDGSSRALNKEEQEGLNIFINKGCAACH
NGVNLGGSMQAFEVAKSYKYRKVGGFAGNKQGLVKTPTLRNVMETMPYFHNGQFWDIKDA
IKEMGGIQLGVKISDDEAKKIESFFNTLTGDKPQIIYPMLPAVTNKTPKPTFR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatatttaggagttttgcttgcctttagtgtaatgctccaagctaatgatatg
gtttatgatagtgcgcttattaagaaagctaaagaagcagggcttgtatcaatgcctagt
gggaaaaagcttaaggatatccaaattcaaaaagccaaagaatctaaacttgcagaggct
tatccaaacaaaatgacaaaagaacaaattgaattaggcaaaaagttgtattttgaccct
cgtatttctagttctaatcttatttcttgtaacacttgtcataatgtgggacttgcaggt
gtagatattgtgcctgcagctattgggcataaatggacccacaatccctctcatttaaat
tctccaacggtgtataattctgtgtttaatagtgcgcaattttgggacgggcgctctgca
catttgggagaccaagctcaaggaccaatccaagctgcacctgaaatgaatgctcaaccc
aaagttgttgttgctaagattacttcaattccagcatatgttgaggaatttaaaaaagct
tatggtaaagatgtaaagattgattttaaactcattgctgatacaatcgcaatgtttgag
catactttagttacacctgctcgtattgataagtttttagacggaagctcaagggcttta
aacaaggaagagcaagagggtttaaatatctttattaataaaggttgtgctgcttgccat
aatggagtgaatcttggtggttcaatgcaggcttttgaagtggcaaagagttataaatat
agaaaagttggtggctttgcaggaaataaacaaggtttggtgaaaacacctacattgcgc
aatgtaatggaaacaatgccttattttcataatgggcaattttgggatataaaagatgcc
attaaagaaatgggaggaatacagcttggcgtaaaaattagtgatgatgaggcaaaaaaa
attgaaagctttttcaatactcttacaggggataaacctcaaattatttatcctatgctt
ccagctgtaacaaataaaactccaaaacctacttttagataa

DBGET integrated database retrieval system