KEGG   Haloarcula hispanica ATCC 33960: HAH_0215Help
Entry
HAH_0215          CDS       T01597                                 

Gene name
pdhC1
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00010  Glycolysis / Gluconeogenesis
hhi00020  Citrate cycle (TCA cycle)
hhi00620  Pyruvate metabolism
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01120  Microbial metabolism in diverse environments
hhi01130  Biosynthesis of antibiotics
hhi01200  Carbon metabolism
Module
hhi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_0215 (pdhC1)
   00020 Citrate cycle (TCA cycle)
    HAH_0215 (pdhC1)
   00620 Pyruvate metabolism
    HAH_0215 (pdhC1)
Enzymes [BR:hhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HAH_0215 (pdhC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H RnfC_N CAT
Motif
Other DBs
NCBI-ProteinID: AEM55848
UniProt: G0HRL5
Position
I:complement(192805..194445)
Genome map
AA seq 546 aa AA seqDB search
MFEFNLPDLGEGVAEGEVLTWHVSPGDAVTEDQVLAEVETDKAAVDVPSPVDGVVQELHA
EVGEMVQTGEVLITIDEAGDAEAADAAAGSAADAESAEATTEAVADDTASEATAADASDQ
SDASTADGRVFASPSVRRLAREKGVDIAAVDGSGPGGRVTEGDVEAATASADETADSDDG
PTSVVSEASDDGDGPTTAVSQVDDADTDDGNAVKSAVRSVSGDGQAAANRDQTLATPATR
KAARELDVNIDAVPTDQTRDGQPYVDESAVRTYAEAQQAAQAADAEAVSAEGGAAGTAAE
AGGAGAETTAVETGDGERREPYRGVRRSIGEQMARSRREVPHATHHDQVDVSGLVEAHER
LQPLAEERDVTLTYTPFVVKCVAAALDQHPVLNTALDTENEEIVYRDVHNIGVAAATDHG
LVVPVVDDVDGKCLVELADEINDLVGRARERDIERSEMQGGTFTVTNFGAIGGEYASPII
NVPETAILGIGALKERPVAEDGEVVAKPTLPLSLAIDHRVIDGADAARFVNTLKEYLTDP
TRLLLE
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagttcaatctcccggacctcggtgaaggggtcgcagagggtgaggtgctgacc
tggcacgtctcgccgggcgacgccgtcaccgaggatcaggtcctcgcggaggtagaaacc
gacaaggccgccgtcgacgtgccgtcgccggtcgacggcgtcgtgcaggaactgcacgcc
gaagtcggcgagatggtacagaccggcgaggtgctcatcactatcgacgaggcgggcgat
gccgaagcggccgacgcggcggctggcagtgcggccgacgccgaatcggcagaagctacc
acagaggcagtagccgacgacactgcgagcgaagccacagcggccgatgcgtcggaccag
tcggacgcaagcacggccgacggccgcgtgttcgcctcgccgagcgttcgccgactcgcc
cgtgagaagggggtcgacatcgcggccgtcgacgggagcgggccgggcggtcgcgtcacc
gagggggacgtcgaggcggccacggcgtcagccgatgagacggctgacagtgacgacggc
cccacgtcggtcgtttcggaggcgtccgacgacggggacggcccgaccacagcagtttcg
caggtcgacgatgcggacacagacgacgggaatgctgtcaagtcagccgtcagaagtgtc
tccggtgacggacaggcggccgccaatcgcgaccagacgctggcgacgccggcaaccaga
aaggccgcccgcgaactcgacgtgaacatcgacgccgtcccgaccgaccagacccgggac
ggccagccctacgtcgacgagtcggccgttcggacgtacgcggaggcacaacaggccgcg
caggcggctgatgccgaagccgtcagcgccgaaggtggtgcggcgggaacggcagccgag
gcgggcggcgctggggccgaaacgacagccgtcgagacaggcgacggcgagcgccgcgaa
ccgtaccgtggcgtccgtcggtccatcggcgaacagatggctcggtcccggcgagaggtg
ccccacgcgacccaccacgaccaggtcgacgtgtccggcctcgtcgaggcacacgagcga
ctacaaccgctcgccgaggagcgcgacgtcacgctgacgtacacgcccttcgtggtgaaa
tgcgtcgccgcggcgctggaccagcacccggtgctcaacaccgcgcttgacaccgaaaac
gaggaaatcgtctacagggacgtccacaacatcggcgtggcggcagcgaccgaccacgga
ctggtcgtgccggtcgtcgacgacgtggacgggaagtgcctggtcgaactcgcagacgag
atcaacgacctcgtcgggcgggcccgagagcgtgacatcgagcggtcggagatgcagggc
gggacgttcaccgtcacgaacttcggggccatcggcggcgagtacgccagcccgataatc
aacgtcccagagacggcgattctcgggatcggggcgctgaaggagcggccggtggccgaa
gacggcgaggtcgtcgcaaaacccacgctcccgctctcgctagcaatcgaccaccgcgtc
atcgacggggcagacgccgcacgcttcgtcaacacgctcaaggagtacctgacggacccg
acgcgactcctgttagagtag

DBGET integrated database retrieval system