KEGG   Haloarcula hispanica ATCC 33960: HAH_0273Help
Entry
HAH_0273          CDS       T01597                                 

Gene name
hmcA
Definition
protporphyrin IX magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hhi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(248647..250809)
Genome map
AA seq 720 aa AA seqDB search
MVVLGDGKKASQEASFAAVVGQRDLKDGLLAVATDDDLDGLLVRGEKGTAKSTAVRALAD
LLPEQRAVADCPYGCPPDRPEAQCDDCRTRADPPVETRSVPLVTLPLGATRDRVVGTLSV
ADALDGDHEFDPGLLARANRGILYVDEVNLLDDHLVDVLLDAAASGQNRVERDGVTVSHP
AEFTLVGTMNPEEGDLRPQLRDRFALQTEVSACENLDDRVAIIDQALGEDGDEEMQSEPD
RDPGERLRTARELLPEVALAREFREQIAELCRDAGLDGHRGDIATARAARTFAALDGRTT
VLESDIERAAEFALPHRLTSRPFEDAPDVDDVLDDHFEDGEDESEEQSDDDGENGDEEGD
AEDDGEEAGAGDESVNDGADSEGGEDGSEQQEQRPDDSGDAGEGGDDESGERGEQPTPTS
ADSDGERQEAEAGDGEGAAGDDGGEGESNQSDDPENATPLLPGQSRATVGDSGAPDVDAP
SVDTDGGSASGRASATGTKRGATVRTERAGRDDEVDAAASVRAAASRGSGHVESRDLRKS
VRAGDAETLVVFAVDASASMRPAMKAAKGTVLELLKDAYQARDQVAFVTFAGEGADVVLP
PTESVSLAARHLKDLPTGDRTPLPDGLAAAREVLDRADPDAGVVVVVTDGRANTADGSPV
AATRNAARTLGEAADRTVVVDAGEGSRAGLLDLVADETDASVVPLDALTAERVDAVASKR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggttgtactcggcgacggcaaaaaagcttcgcaggaggcctccttcgcagccgtggtg
ggccagcgggacctcaaagacgggttgctggccgtcgcgacagacgacgacctcgacggc
ctgctcgttcgcggcgagaaggggacggcgaaatcgacggccgtgcgcgccctcgccgac
ctgctgcccgagcagcgcgcggtcgcggactgtccctacggctgtccaccggacaggccg
gaggcccagtgtgacgactgccggacgcgggcggacccacccgtcgagacgcggtcggtg
ccactcgtcacgctcccgctgggcgcgacccgggaccgcgtcgtcgggacgctgtcggtg
gccgacgcgctcgacggcgaccacgagttcgaccccggcttgctggcccgcgcgaaccgc
ggcatcctctacgtggacgaggtgaacctgctggacgaccacctcgtcgacgtgctgctc
gacgctgctgcgagcggccagaaccgggtcgagcgcgacggcgtcaccgtttcccacccc
gccgagttcaccctcgtcgggacgatgaaccccgaggagggcgacctccgcccgcagttg
cgggaccgattcgccctgcagaccgaggtgtcggcctgcgagaacctcgatgaccgtgtc
gctatcatcgaccaagcactgggagaggacggcgacgaggagatgcagagcgaacccgac
cgcgacccgggcgagcgcctgcggaccgcccgcgaactgctgcccgaggtcgccctcgcc
cgcgagttccgcgagcagatcgccgaactctgtcgggacgccggcctcgacggtcaccgc
ggcgacatcgccaccgcgcgggcggcccggacgttcgccgcgctcgacgggcggacgacg
gttcttgaatcagacatcgagcgcgccgccgagttcgcgctcccccaccggctcacctcc
cggcccttcgaggacgcgccggacgtggacgacgtgctcgacgaccatttcgaggacggc
gaggacgaatccgaggagcagtccgacgacgacggagaaaacggtgacgaggaaggtgac
gcggaagacgatggagaggaagcgggggccggcgacgagtcagtaaacgacggagccgat
tccgaaggcggtgaggacggaagcgaacagcaagaacagcggccggacgacagcggtgac
gccggcgagggcggcgacgacgagtcaggcgagcgcggcgagcagccaacgcccacctcg
gccgacagcgacggcgagcggcaggaagcagaggccggcgacggcgaaggagcggccgga
gacgacggtggggagggagagtccaaccagtccgacgacccggaaaacgccaccccgctg
ctgccgggccagtcccgcgccacagtcggcgacagcggcgcacccgacgtggatgccccg
tcggtcgacaccgacggtgggagcgcaagcggccgtgcgagcgcgacagggacgaaacgc
ggtgcaacggtccgaaccgagcgcgccggccgggacgatgaggtcgacgccgcagcgtcg
gtccgggcggcggccagtcgcgggagcggccatgtcgagtcacgtgaccttcggaagtcc
gttcgtgcaggcgacgccgagacgctggtcgtgttcgccgtcgacgcaagcgcgtcgatg
cgcccggcgatgaaagccgcgaaggggactgtgctggaactgttgaaggacgcctaccaa
gcccgcgaccaggtcgcctttgtcaccttcgccggcgagggcgcggacgtggtcctcccg
ccgaccgagagcgtctcgctggcggcccgacacctgaaggacctcccgaccggcgaccgg
acgccgctgccggacgggctggcggccgctcgggaagtgctcgaccgggcggacccggac
gccggcgttgtcgtcgtcgtgaccgacggccgggcgaacaccgccgacgggagtccggtc
gcagcgaccagaaacgcggcgcggacgctcggcgaagcagccgaccgcaccgtcgtcgtg
gatgcgggcgaagggagtcgcgccggtctgctcgacctcgttgctgacgaaacggacgcg
tcggtcgtcccgctggacgcgctgaccgccgagcgcgtcgacgccgtcgccagcaagcga
taa

DBGET integrated database retrieval system