KEGG   Haloarcula hispanica ATCC 33960: HAH_0273Help
Entry
HAH_0273          CDS       T01597                                 

Gene name
hmcA
Definition
protporphyrin IX magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HAH_0273 (hmcA)
Enzymes [BR:hhi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HAH_0273 (hmcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(248647..250809)
Genome map
AA seq 720 aa AA seqDB search
MVVLGDGKKASQEASFAAVVGQRDLKDGLLAVATDDDLDGLLVRGEKGTAKSTAVRALAD
LLPEQRAVADCPYGCPPDRPEAQCDDCRTRADPPVETRSVPLVTLPLGATRDRVVGTLSV
ADALDGDHEFDPGLLARANRGILYVDEVNLLDDHLVDVLLDAAASGQNRVERDGVTVSHP
AEFTLVGTMNPEEGDLRPQLRDRFALQTEVSACENLDDRVAIIDQALGEDGDEEMQSEPD
RDPGERLRTARELLPEVALAREFREQIAELCRDAGLDGHRGDIATARAARTFAALDGRTT
VLESDIERAAEFALPHRLTSRPFEDAPDVDDVLDDHFEDGEDESEEQSDDDGENGDEEGD
AEDDGEEAGAGDESVNDGADSEGGEDGSEQQEQRPDDSGDAGEGGDDESGERGEQPTPTS
ADSDGERQEAEAGDGEGAAGDDGGEGESNQSDDPENATPLLPGQSRATVGDSGAPDVDAP
SVDTDGGSASGRASATGTKRGATVRTERAGRDDEVDAAASVRAAASRGSGHVESRDLRKS
VRAGDAETLVVFAVDASASMRPAMKAAKGTVLELLKDAYQARDQVAFVTFAGEGADVVLP
PTESVSLAARHLKDLPTGDRTPLPDGLAAAREVLDRADPDAGVVVVVTDGRANTADGSPV
AATRNAARTLGEAADRTVVVDAGEGSRAGLLDLVADETDASVVPLDALTAERVDAVASKR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggttgtactcggcgacggcaaaaaagcttcgcaggaggcctccttcgcagccgtggtg
ggccagcgggacctcaaagacgggttgctggccgtcgcgacagacgacgacctcgacggc
ctgctcgttcgcggcgagaaggggacggcgaaatcgacggccgtgcgcgccctcgccgac
ctgctgcccgagcagcgcgcggtcgcggactgtccctacggctgtccaccggacaggccg
gaggcccagtgtgacgactgccggacgcgggcggacccacccgtcgagacgcggtcggtg
ccactcgtcacgctcccgctgggcgcgacccgggaccgcgtcgtcgggacgctgtcggtg
gccgacgcgctcgacggcgaccacgagttcgaccccggcttgctggcccgcgcgaaccgc
ggcatcctctacgtggacgaggtgaacctgctggacgaccacctcgtcgacgtgctgctc
gacgctgctgcgagcggccagaaccgggtcgagcgcgacggcgtcaccgtttcccacccc
gccgagttcaccctcgtcgggacgatgaaccccgaggagggcgacctccgcccgcagttg
cgggaccgattcgccctgcagaccgaggtgtcggcctgcgagaacctcgatgaccgtgtc
gctatcatcgaccaagcactgggagaggacggcgacgaggagatgcagagcgaacccgac
cgcgacccgggcgagcgcctgcggaccgcccgcgaactgctgcccgaggtcgccctcgcc
cgcgagttccgcgagcagatcgccgaactctgtcgggacgccggcctcgacggtcaccgc
ggcgacatcgccaccgcgcgggcggcccggacgttcgccgcgctcgacgggcggacgacg
gttcttgaatcagacatcgagcgcgccgccgagttcgcgctcccccaccggctcacctcc
cggcccttcgaggacgcgccggacgtggacgacgtgctcgacgaccatttcgaggacggc
gaggacgaatccgaggagcagtccgacgacgacggagaaaacggtgacgaggaaggtgac
gcggaagacgatggagaggaagcgggggccggcgacgagtcagtaaacgacggagccgat
tccgaaggcggtgaggacggaagcgaacagcaagaacagcggccggacgacagcggtgac
gccggcgagggcggcgacgacgagtcaggcgagcgcggcgagcagccaacgcccacctcg
gccgacagcgacggcgagcggcaggaagcagaggccggcgacggcgaaggagcggccgga
gacgacggtggggagggagagtccaaccagtccgacgacccggaaaacgccaccccgctg
ctgccgggccagtcccgcgccacagtcggcgacagcggcgcacccgacgtggatgccccg
tcggtcgacaccgacggtgggagcgcaagcggccgtgcgagcgcgacagggacgaaacgc
ggtgcaacggtccgaaccgagcgcgccggccgggacgatgaggtcgacgccgcagcgtcg
gtccgggcggcggccagtcgcgggagcggccatgtcgagtcacgtgaccttcggaagtcc
gttcgtgcaggcgacgccgagacgctggtcgtgttcgccgtcgacgcaagcgcgtcgatg
cgcccggcgatgaaagccgcgaaggggactgtgctggaactgttgaaggacgcctaccaa
gcccgcgaccaggtcgcctttgtcaccttcgccggcgagggcgcggacgtggtcctcccg
ccgaccgagagcgtctcgctggcggcccgacacctgaaggacctcccgaccggcgaccgg
acgccgctgccggacgggctggcggccgctcgggaagtgctcgaccgggcggacccggac
gccggcgttgtcgtcgtcgtgaccgacggccgggcgaacaccgccgacgggagtccggtc
gcagcgaccagaaacgcggcgcggacgctcggcgaagcagccgaccgcaccgtcgtcgtg
gatgcgggcgaagggagtcgcgccggtctgctcgacctcgttgctgacgaaacggacgcg
tcggtcgtcccgctggacgcgctgaccgccgagcgcgtcgacgccgtcgccagcaagcga
taa

DBGET integrated database retrieval system