KEGG   Haloarcula hispanica ATCC 33960: HAH_0481Help
Entry
HAH_0481          CDS       T01597                                 

Gene name
acs1
Definition
acyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_0481 (acs1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_0481 (acs1)
   00620 Pyruvate metabolism
    HAH_0481 (acs1)
   00640 Propanoate metabolism
    HAH_0481 (acs1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HAH_0481 (acs1)
   00680 Methane metabolism
    HAH_0481 (acs1)
Enzymes [BR:hhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HAH_0481 (acs1)
Lipid biosynthesis proteins [BR:hhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HAH_0481 (acs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(448146..450140)
Genome map
AA seq 664 aa AA seqDB search
MSDEDVQLEARLEEQEVFEPPESFVEQANVTDEGIYEEFTENWPECWEGAADLLDWEEGY
DQVLDDSNPPFYEWFTDGKLNASANCLDRHLEERGDEAAIEWVGEPVEEDNITYTYEELH
QKVNEFAAGLREMGVGEDDVVTMYMPMIPQLPIAMLACARIGAPHSVVFAGFSADALATR
MDSADSEYLVTCDGYYRRGDPLDHLDKANEGLSGVDHEVERAIVAERLMDGDGFDHDYAG
NQVAFDDVIADNEGETVEPVDRDAEDMLFLMYTSGTTGKPKGVKHSTGGYLAWAAWTSQA
VLDIKPEDTYFCSADIGWITGHSYIVYGPLALGTTTMMYEGTPDYPDKDRLWDIVEEYEA
DQLYTAPTAIRAFMKWGKQYPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGGEECPVVD
TWWQTETGGMMITTLPGVKDMKPGSAGPPLPGNDVRIVDTEGKEVEPGRAGYLTVDKPWP
GMLRTLYKNDERFIDEYWAEYSDTDSDDSDDWVYFPEDGAKIDDDGYITVLGRVDDVINV
SGHRLGTMEIESAIVGVEGVAEAAVVGGDHDIKGEAVYAYVITEDGYEEDEDLRSAIIDG
VEDAIGPIARPEAVIFTPELPKTRSGKIMRRLLEDIANGEELGDTSTLRNPDVVSDIETK
VQGD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgaagatgtccaactcgaagcacggctcgaagaacaggaggttttcgagccc
ccggagtcgttcgtcgagcaggcgaacgtcacggacgagggtatctacgaggagtttacc
gaaaactggccggagtgctgggagggggccgccgacctgctcgactgggaggagggttac
gatcaggtactcgacgactcgaacccgccgttctacgagtggttcacggacgggaaacta
aacgcctcggcgaactgtctggaccgccatttggaggagcgcggcgacgaagccgctatc
gagtgggtgggtgagccggtcgaggaagacaacatcacctacacctacgaggaacttcac
cagaaggtcaacgagttcgcggccggcctgcgggagatgggcgtcggcgaggacgacgtc
gtgacgatgtacatgccgatgatcccgcagctgccgatagccatgctggcctgtgcccgc
atcggcgcgccacactccgtcgtgttcgccggcttctccgcggacgcgctcgcgacgcgg
atggactccgccgactcggagtatctggtcacctgcgacggctactaccgacgaggggac
ccgctcgaccacctcgacaaagccaacgaggggctgagcggcgtcgaccacgaggtcgaa
cgcgccatcgtcgccgagcgcctgatggacggcgacggcttcgaccacgactacgcgggc
aatcaggtcgccttcgacgatgtcatcgccgacaacgagggcgagacggtcgaaccggtc
gaccgcgacgccgaggatatgctgtttctcatgtacacctccgggaccaccgggaagccg
aaaggcgtcaaacactccacgggtggctacctcgcgtgggcagcctggacctctcaggca
gtgctcgatatcaaacccgaggacacgtacttctgctcggccgacatcggctggattacc
ggccactcctacatcgtctacggcccgctcgcgctcgggacgacgacgatgatgtacgag
gggacgccggactaccccgacaaggaccgcctctgggacatcgtcgaggaatacgaggcc
gaccagctgtacaccgcgccgacggccatccgcgcgttcatgaagtggggcaagcagtac
cccgaacagcacgacctctccagcctgcgcctgctggggacggtcggtgagccgatcaac
cctcgcgcctggaaatggtactacaaacatatcgggggcgaggagtgccccgtcgtcgac
acctggtggcagaccgagaccggcggcatgatgataacgacgctgcccggcgtcaaggac
atgaaacccgggtcggccgggccgccgctaccgggcaacgacgtccgcatcgtcgacacc
gagggtaaggaagtcgaacccggccgcgccggctacctgaccgtcgacaagccgtggccc
ggcatgctccggacgctgtacaagaacgacgaacggttcatcgacgaatactgggccgag
tactcggacaccgatagcgacgactccgacgactgggtgtacttccccgaggacggagcg
aagatcgacgacgacggctacatcaccgtgctggggcgggtcgacgacgtgatcaacgtc
tccggccaccgcctcgggacgatggagatcgagagcgctatcgtcggcgtggaaggcgtc
gccgaagccgctgtcgtcggtggcgaccacgatatcaagggcgaagcggtgtacgcgtac
gtcatcaccgaggacggctacgaggaagacgaagacctccgtagtgcgattatcgacggc
gtcgaggacgctatcgggccaatcgcgcggccggaagccgtcatcttcacgcccgaactg
ccgaagacccgctccgggaagatcatgcgccgcctgctggaagacatcgccaacggcgag
gaactgggcgatacgagcacgctgcgaaaccctgacgtcgtcagtgatatcgagaccaaa
gtccagggtgactga

DBGET integrated database retrieval system