KEGG   Haloarcula hispanica ATCC 33960: HAH_0483Help
Entry
HAH_0483          CDS       T01597                                 

Gene name
acs2
Definition
acyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_0483 (acs2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_0483 (acs2)
   00620 Pyruvate metabolism
    HAH_0483 (acs2)
   00640 Propanoate metabolism
    HAH_0483 (acs2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HAH_0483 (acs2)
   00680 Methane metabolism
    HAH_0483 (acs2)
Enzymes [BR:hhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HAH_0483 (acs2)
Lipid biosynthesis proteins [BR:hhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HAH_0483 (acs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(452043..453986)
Genome map
AA seq 647 aa AA seqDB search
MTRGDEPDRGQSQTGRETVEPPDWFVEQANVTDPAVYNRFEREWPDCWREAAALLDWEVP
FETVLRGTDGPPFEWFPGGRLNAAYNCLDRHLPERKNQLALVWEGHLGESSTYTYLELYR
EVNAFAAALRERGVGPDDVVTLYLPMVPELPIAMLACARLGVAHNVVFAGFSADALATRM
ERADSEYLITCDGYYRRGSAVAQKNKADNARIAVDHDVSVVVLDRLGRDVHLGDDYDDYH
DLLAAHEGEEVEPVSRAADDPLFRIYTSGTTGQPKAVTHTTGGYLAHVAWTARSVLDIKP
EDTYWCSADIGWITGHSYIVYGPLALGTTTVLYNGTADHPKKDQLWELIEKYAVDVFYTA
PTAVRAFMKWGEEYPDRHDLSSLRLLGTVGEPMDARAWEWYREHIGGGECPIVDTWWQTE
TGAVLVSTLPGVDEMKPGAAGTPLPGIEASVVDREGAAVESDTAGELVVTRPWPGMPRAL
LDGTGWGSAPDSAGEWRYYPEDSVSVDADGYITFLGRIDDAINVAGRRFSTKELESTVAG
VTGVAEAAVVGADDETTGTAVYAFASPEDGYAESELRAAIEEGVVNAIGGIARPKEIVFT
PDLPKTRSGKVMRRLLTAVANDEDLGDTSALRNPEILGEIQSTTRKE
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgacacggggtgacgaaccggatcggggccagtcccagacggggcgagagacagtcgaa
ccaccggactggttcgtcgaacaggcgaacgtgacggacccggccgtctacaaccgcttc
gaacgggagtggcccgattgctggcgcgaggccgccgcgttgcttgactgggaggttccg
ttcgagacggtgctccgtggaacagacgggccaccgttcgaatggttccccggtggccga
ttaaacgccgcatacaactgtctcgaccgacacctccccgagcggaagaaccagctcgca
ctggtctgggaggggcacctcggcgagtccagcacctacacctacctcgaactgtaccgg
gaagtcaacgccttcgccgcggcgttgcgcgagcgcggcgtcggcccggacgacgtggtg
acgctgtacctgccgatggtgcccgaactcccgatcgcaatgctggcctgtgcgcgcctg
ggtgtggcacacaacgtcgtcttcgccgggttctccgcggacgcactggcgacgcgaatg
gagcgggccgactcggagtatctcatcacctgcgatggctactaccgccgcggtagcgcc
gtcgcacaaaagaacaaggcggataacgcgcgcatcgccgtcgaccacgacgtgtcggtc
gtggtgctcgaccggctgggccgtgatgtgcacttaggcgacgactacgacgactatcac
gacctgctggcggcccacgagggcgaggaagtcgagccggtttcgcgggcggcggacgac
ccgctctttcgcatctacacatcggggacgaccggccagccgaaggccgtcacccacacg
accggcgggtatctcgcacacgtcgcctggaccgcccggtcggtcctggatatcaagccc
gaggacacctactggtgttcggccgacatcggctggattaccggccactcctacatcgtc
tacggcccgctcgcgctcggcacgacaacagtactgtacaacggtacggcggaccacccc
aaaaaggatcagctgtgggaactcatcgagaagtacgccgtcgacgtgttctacaccgcg
ccgacagccgttcgggcgttcatgaagtggggcgaggagtaccccgaccgacacgacctc
tccagtctacgcctgctgggtacggtcggcgaaccaatggatgctcgcgcatgggagtgg
tatcgcgagcacatcggcggcggcgagtgccccattgtcgacacatggtggcagaccgaa
accggagcggtgctcgtatcgacgttgcccggcgtcgacgagatgaaacccggggccgcg
ggaacgccgctgccaggaatcgaggcgtccgtcgtcgaccgcgaaggtgcggcggtcgag
tcggacacggccggcgaactcgtcgtgacgcgcccctggccggggatgccccgcgcgtta
cttgacgggacgggctggggcagcgccccggacagcgccggggaatggcggtactacccc
gaagacagcgtctcggtcgacgctgacggttacatcacctttctcggtcggattgacgac
gcgattaacgtcgccggccggcggttcagcaccaaggaacttgagtcgacggtcgccggc
gtcaccggcgtcgccgaagccgccgtcgtcggtgccgacgacgagacgaccggaacggcg
gtgtacgcgttcgcctccccggaggacggctacgccgagagcgaactccgagcagccatc
gaagagggcgtcgtcaacgctatcggtggtatcgcccgccccaaggaaatcgtgttcacg
cccgaccttccgaagacgcgctcgggcaaggttatgcgccgcctgctgacggcagtggcc
aacgacgaggacctgggcgacaccagcgcgctacggaaccccgaaatcctcggcgaaatc
cagtcgacgacgagaaaggagtga

DBGET integrated database retrieval system