KEGG   Haloarcula hispanica ATCC 33960: HAH_0990Help
Entry
HAH_0990          CDS       T01597                                 

Gene name
folP2
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hhi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(941048..942205)
Genome map
AA seq 385 aa AA seqDB search
MRTVEIDGLPVGDGHPTRVMSVLNMSSNSGYKPSVYLDPAEAADAIEENLVPAGADIIDV
GLQSANPKYESKPVEMEKDRLEEVAPLVDELDADVPLSLETRYAEVAEEAIGHGFDLIND
VCGFADPEMKGVVEDHDMPVVKMASPPDLARPGALKSIDDIFEALQRDGFTDKTIIDPAF
GGWYDGKEFEDNWEMFRRLREFRAFDRPMLTATNREDFLGDLADQPETENQLAVSLAAAT
MEVERGAHIIRTHDTRETHDVVKVADALGDERTTRAETEPGPTVAELTDVTLREVARHQA
LGETVAGGTDDGATLTFLLGDLTDDARASLRAVAEVTDVVVVEKDSGSLYVGGAAVALKV
VADSLAEDGHRELAGELRASLSRRV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacggtcgaaatcgacggcctcccggtgggtgatgggcacccgacacgcgtcatg
agcgtgttgaacatgagttcgaactccgggtacaagccgagcgtgtatctggaccccgcg
gaagccgccgacgcaatcgaggagaacctcgtccccgccggcgcagacatcatcgacgtc
ggcctccagtcggccaaccccaagtacgagtccaagccggtcgagatggagaaagaccgg
ctcgaagaggtcgcgccgctcgtcgacgaactcgacgccgacgtgccgctgtcgctcgaa
actcggtacgcagaggtcgccgaggaggccatcggccacgggtttgaccttatcaacgac
gtgtgtggcttcgccgacccggagatgaaaggtgtcgtcgaagaccacgacatgccggtc
gtcaagatggccagtccgccggacctggcccggcccggcgcgctgaagagcatcgacgac
atcttcgaggcgctccagcgggacgggttcacggacaagacaatcatcgacccggcattc
ggcggctggtacgacggcaaggagttcgaggacaactgggagatgttccgccgcctccga
gagttccgcgccttcgacagaccgatgctcacggcgaccaaccgcgaggacttcctcggt
gacctggccgaccagcccgagacggagaaccaactcgccgtgtcactggctgcggcgacg
atggaagtcgaacgcggggcccacatcatccgaacgcacgacacacgcgagacccacgac
gtggtcaaggtggccgacgcgctcggcgacgagcggacgacgcgtgccgaaactgagccc
ggccccaccgtggcggaactgaccgacgtgacgctgcgggaggtggcccggcatcaggcc
ctcggcgagacggtcgccggcggcaccgacgacggcgcgacgctgacgttcctgctcggt
gacctgaccgacgacgcacgggcaagtctccgggccgtcgccgaggtgaccgacgtggta
gtcgtcgagaaagacagcggcagcctctacgtcggcggcgccgcggtagcactgaaagtg
gtcgccgacagcctcgccgaagacggccaccgcgaactcgccggcgagttgcgagcgtcg
ctatcgcggcgtgtgtag

DBGET integrated database retrieval system