KEGG   Haloarcula hispanica ATCC 33960: HAH_0993Help
Entry
HAH_0993          CDS       T01597                                 

Gene name
suk
Definition
sugar kinase, ribokinase (EC:2.7.1.11)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HAH_0993 (suk)
Enzymes [BR:hhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HAH_0993 (suk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(944650..945534)
Genome map
AA seq 294 aa AA seqDB search
MDMRVICAGHVNWDVTLHVDHFPKPDGEGRITDRSQSSGGSASNAAVALAGLDADPLVLG
SVGRDDHGTMARRELAAAGVETLLVESDEPTAVKYLIVDENGGVAVLGNDGANEAFCASD
LPAETLAEADHLHLTGQDPATAATLARDAAAADVPVSFDPGRRLPYRDYSAVLSHADLLF
CNDREADHAEDSGLFDTVPTVVVKHGDCGATAYIDDRTVTNAGYPIESVDTAGAGDAFAA
GYLLASAEETNPERALAVANACGALAAQSPGAQTTLDWESVWELVDSGQSPETA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgcgcgtcatctgtgccggccacgtcaactgggacgtgacgctccacgtcgac
cacttcccgaagcccgacggcgaggggcgcatcaccgaccggtcacagtccagcggaggg
agcgcgtcgaatgcggccgtcgcactcgccgggcttgatgcggacccgctggtcctcggg
agcgtcggccgggatgaccacggtaccatggctcggcgcgaactggcggcggccggcgtc
gagacgctactggtcgagtcggacgaaccgacggcggtgaaatacctcatcgtggacgag
aacggcggcgtcgcggtgcttggaaacgacggggccaacgaggcgttctgtgcgtcagat
ctcccggccgagaccctggccgaggcagaccacctccatctgaccggccaggaccccgcg
acggctgcgacgctcgcccgcgacgccgcggccgcggacgtcccggtgagcttcgacccc
ggccgtcggctcccgtaccgcgattactcggcggtgctctcacacgcggatctcctgttt
tgcaacgaccgggaggccgaccacgccgaggacagcggccttttcgacacagtgccgacg
gtcgtcgtcaaacacggggactgcggcgcgacagcctatatcgacgaccggacagtcacg
aacgccgggtatcccatagaatctgtggacaccgcaggcgcgggggacgcgttcgccgcc
gggtaccttctcgccagtgcagaggagaccaatccggaacgggcgctcgcagtcgccaac
gcctgtggcgcgctcgcagcgcagtcacccggcgcacagacgacactcgactgggagtct
gtgtgggagcttgtcgacagcgggcaatcgcccgagacggcctaa

DBGET integrated database retrieval system