KEGG   Haloarcula hispanica ATCC 33960: HAH_1240Help
Entry
HAH_1240          CDS       T01597                                 

Gene name
arg2
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
hhi00220  Arginine biosynthesis
hhi00330  Arginine and proline metabolism
hhi01100  Metabolic pathways
hhi01110  Biosynthesis of secondary metabolites
hhi01130  Biosynthesis of antibiotics
hhi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HAH_1240 (arg2)
   00330 Arginine and proline metabolism
    HAH_1240 (arg2)
Enzymes [BR:hhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HAH_1240 (arg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEM56855
UniProt: G0HY54
Position
I:1180758..1181663
Genome map
AA seq 301 aa AA seqDB search
MSPVAVLGVPFALGADRRGVDMGPSAIRYGGLSTALDTAGVEYTDAGDLALPTLQSQSAT
TDDGAKYLDAIAEMTDTLADRVATEIADGSVPLVLGGDHSIAMGTMRGAAQTAELGVIWF
DAHGDYNTPTTSPSGNVHGMPLAAAHGYGDFAEMPWATAPNVAEENTAIVGARSLDADER
AVLRESDISVFTMEDIDRRGIGPVTDEALDIATDGVDDIHVSLDLDWLDPDDAPGVGTPV
PGGVTYREAHTAMERVADRDAAESVLRSLDVVEVNPILDQRNTTGERAAELAASAFGKRI
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacctgtcgcggtgctcggtgtccccttcgcgctcggcgccgaccggcgtggcgtc
gacatggggccgtcggcgattcgctacggcggcctcagtaccgccctcgatacggccggc
gtcgaatacactgacgctggggacctcgcactgccgacgctacagtcgcagtcggcgacc
accgacgacggcgcgaagtacctcgatgcgatcgccgaaatgaccgacaccctcgccgac
cgggtggcgacggaaatagccgacgggagcgtgccgctggtgttaggcggcgaccactct
atcgcgatgggcacgatgcgcggcgcggcccagacggccgaactcggcgtcatctggttc
gacgcccacggcgattacaacaccccgactacgtcgcctagcgggaacgtccacggtatg
ccgcttgcggccgcccacggctacggcgacttcgcagagatgccgtgggcgaccgccccg
aacgtcgccgaggagaacaccgccatcgtcggagcgcggagcctcgacgctgacgaacga
gcggtcctccgtgagagcgacatctccgtctttaccatggaagatatcgacaggcgcggt
atcggaccggtcaccgacgaggcgctcgacatcgcgaccgacggcgtcgacgacatccat
gtcagcctcgacctcgactggctcgacccggacgacgcgccgggggtcgggacgccagtc
ccgggcggcgtcacctaccgggaggcacatacggcgatggaacgggtcgccgaccgcgac
gccgccgaatcggtgctgcgctcgctcgacgtcgtcgaggtcaaccctatcctcgaccag
cgcaacacgacgggcgaacgagcggccgaactcgccgccagcgcgttcggcaagcggatc
ctgtag

DBGET integrated database retrieval system