KEGG   Haloarcula hispanica ATCC 33960: HAH_1240Help
Entry
HAH_1240          CDS       T01597                                 

Gene name
arg2
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAH_1240 (arg2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HAH_1240 (arg2)
Enzymes [BR:hhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HAH_1240 (arg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1180758..1181663
Genome map
AA seq 301 aa AA seqDB search
MSPVAVLGVPFALGADRRGVDMGPSAIRYGGLSTALDTAGVEYTDAGDLALPTLQSQSAT
TDDGAKYLDAIAEMTDTLADRVATEIADGSVPLVLGGDHSIAMGTMRGAAQTAELGVIWF
DAHGDYNTPTTSPSGNVHGMPLAAAHGYGDFAEMPWATAPNVAEENTAIVGARSLDADER
AVLRESDISVFTMEDIDRRGIGPVTDEALDIATDGVDDIHVSLDLDWLDPDDAPGVGTPV
PGGVTYREAHTAMERVADRDAAESVLRSLDVVEVNPILDQRNTTGERAAELAASAFGKRI
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacctgtcgcggtgctcggtgtccccttcgcgctcggcgccgaccggcgtggcgtc
gacatggggccgtcggcgattcgctacggcggcctcagtaccgccctcgatacggccggc
gtcgaatacactgacgctggggacctcgcactgccgacgctacagtcgcagtcggcgacc
accgacgacggcgcgaagtacctcgatgcgatcgccgaaatgaccgacaccctcgccgac
cgggtggcgacggaaatagccgacgggagcgtgccgctggtgttaggcggcgaccactct
atcgcgatgggcacgatgcgcggcgcggcccagacggccgaactcggcgtcatctggttc
gacgcccacggcgattacaacaccccgactacgtcgcctagcgggaacgtccacggtatg
ccgcttgcggccgcccacggctacggcgacttcgcagagatgccgtgggcgaccgccccg
aacgtcgccgaggagaacaccgccatcgtcggagcgcggagcctcgacgctgacgaacga
gcggtcctccgtgagagcgacatctccgtctttaccatggaagatatcgacaggcgcggt
atcggaccggtcaccgacgaggcgctcgacatcgcgaccgacggcgtcgacgacatccat
gtcagcctcgacctcgactggctcgacccggacgacgcgccgggggtcgggacgccagtc
ccgggcggcgtcacctaccgggaggcacatacggcgatggaacgggtcgccgaccgcgac
gccgccgaatcggtgctgcgctcgctcgacgtcgtcgaggtcaaccctatcctcgaccag
cgcaacacgacgggcgaacgagcggccgaactcgccgccagcgcgttcggcaagcggatc
ctgtag

DBGET integrated database retrieval system