KEGG   Haloarcula hispanica ATCC 33960: HAH_1256Help
Entry
HAH_1256          CDS       T01597                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_1256 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_1256 (glk)
   00052 Galactose metabolism
    HAH_1256 (glk)
   00500 Starch and sucrose metabolism
    HAH_1256 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HAH_1256 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HAH_1256 (glk)
   00524 Butirosin and neomycin biosynthesis
    HAH_1256 (glk)
Enzymes [BR:hhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HAH_1256 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1198759..1199730
Genome map
AA seq 323 aa AA seqDB search
MGAYAGVDLGATHIRAVIGDETGSILSSHKTETPRGPAGIAVTEAVLDAIRQACDAADIA
PTDVVAAGIGSFGPMDLAEGVVENPANLPDTIDRIPLTGPVENLIGSERVSLHNDANAGV
IGERFYSDRSPDDMVYLTISSGVGAGVAVDGNILSGWDGNAGEVGHLTIDPHGFMTCGCG
HDGHWEAYCSGENIPRYATQLHREDPVETALPIETEEFSAADIFEYAGEDEFASHVLDQI
CHWNAIGVANIVHAYAPLVVYVGGAVALNNPEQVLDPIRDRLDDMVMSNIPDIQLTQFGD
DVVVRGALASALTGGTGDPSQRV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcttacgcaggggtcgacctcggagcgacacatattcgggctgttatcggtgac
gagacgggttcgatactctcgtcacacaaaactgagacaccgcgtggaccggcaggtatc
gcggtcacggaggcggtcctcgacgcgatccgacaggcctgtgacgccgccgatatcgcc
cccacagacgtggttgccgccggtatcgggtccttcggtccgatggatctggccgaaggg
gtcgtcgaaaaccccgcgaacctccccgacaccatcgaccggattccgctgaccgggccg
gtggaaaatctcatcggcagcgagcgggtgtcgctgcacaacgacgccaacgccggcgtc
atcggtgagcggttctactcggaccggagccccgatgacatggtgtatctcacaatctcc
tccggggtcggtgccggggtcgctgtcgacgggaatatcctctcaggctgggacggcaac
gctggagaagtcggccacttgacgatcgacccacatgggttcatgacctgtggctgtggg
cacgacggccactgggaagcgtactgttcgggcgagaacatcccgcggtacgccacacaa
ctgcaccgggaggaccccgtcgagacggcgctcccgatcgagactgaggagttttccgcg
gcggatatcttcgaatatgccggcgaagacgagttcgcgtcccacgtcctcgaccagatc
tgtcactggaacgcgatcggcgtcgcgaacatcgtccacgcgtacgcgcccctcgtcgtc
tacgtcggtggggccgttgcgctcaacaaccccgagcaggtgctagacccgatccgagac
cggctcgacgacatggtgatgtcgaacattccggatatccagttgacgcagttcggtgac
gatgtcgtagtccgtggcgcactggcgtccgcgctgactggcggcacaggtgacccgtca
cagcgcgtttga

DBGET integrated database retrieval system