KEGG   Haloarcula hispanica ATCC 33960: HAH_1259Help
Entry
HAH_1259          CDS       T01597                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hhi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1202094..1203572)
Genome map
AA seq 492 aa AA seqDB search
MVFDHSGQVVANAYEKHEQIYPEPGWVEHDPVEIWENTQEVVTKGLADAGVGAEQLEALG
ITNQRETTIVWDKETGKPVHNALVWQDRRTTDRVEEIQEEDKVEWIRGKTGLECDAYFSA
TKTEWILDNAEPLKMQSSRGADLRERAEDGELLMGTIDAWLIYKLTGNHITDVSNASRTM
LYNIHDMEWDDELLEEFGVPESMVPEVRPSSDESLYGHTDADGFLEEEVPVAGALGDQQA
ALFGQTCFDKGDAKNTYGTGAFYLMNTGSEAVASDNGLLTTIGFQMSGEPVQYALEGSIF
IAGAAIEWLEDVDLINNAAQTAELARSVESTDGVYMVPAFTGLGAPHWDGRARGTIVGMT
RGTRKEHIVRATLESIAYQTRDLAEAMEEDSGVEMTTLRVDGGAVKNNFLCQLQSDIIQT
DIARPQVDETTALGSAYAAGLAVGYWDTVDELRDNWQVDKEFSPEMDAEKADKMYDRWDD
AVDRSRDWAQEE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtattcgaccatagcggccaggtcgttgcgaacgcctacgagaagcacgaacagatc
tatccggagcccggctgggtcgagcacgaccccgtcgaaatctgggaaaacacgcaggaa
gtcgtgaccaaggggcttgcggatgcaggtgtcggtgccgaacagctggaggcactcggc
atcacgaaccagcgtgagacgacgatcgtctgggacaaagagaccggcaagccggtccac
aacgcgctggtctggcaggaccgccgaaccaccgaccgcgtcgaggagatccaagaggaa
gacaaggtcgagtggatccgggggaagaccgggctggaatgtgacgcctacttctcggca
accaagaccgagtggatcctcgacaacgcggagccactcaagatgcagagctcgcgcggc
gctgacctccgtgagcgggccgaagacggtgaactcctgatggggaccatcgacgcgtgg
ctcatctacaagctcaccggcaaccacatcacggacgtctcgaacgcatcgcggacgatg
ctgtacaacatccacgacatggagtgggacgacgaactcctcgaagagttcggcgtcccg
gagtccatggttccggaagtccgcccgtcctccgacgagagcctgtacggacacaccgat
gcggacggcttcctcgaagaggaagtccccgttgcgggcgcgctgggtgaccagcaggcc
gcactgttcggccagacctgcttcgacaagggtgatgcgaagaacacctacggtaccggc
gcgttctatctgatgaacaccggttccgaagcagtcgcctccgataacggcctgctgacg
acgattggcttccagatgtccggtgaacccgtccagtacgcgcttgaaggctccatcttc
atcgccggcgcggcaatcgaatggctcgaagacgtcgacctcatcaacaacgccgcccag
acggcggaactggcccgctcggtcgaatcgaccgacggtgtctacatggtgccggccttc
acggggctcggcgctccgcactgggacggccgcgctcgcgggacgattgtcgggatgact
cgcggaacgcgaaaagagcatatcgtgcgtgcgaccctggaatccatcgcataccagacc
cgcgacctcgcggaggcgatggaggaagactccggtgtcgagatgacgacgctgcgagtc
gacggcggtgcagtcaagaacaacttcctctgtcagctccagtcggacatcatccagacg
gatatcgcccgcccgcaggtcgacgagaccaccgcactggggtcggcctatgcggccggt
ctcgccgtcgggtactgggacaccgtcgacgagctccgcgacaactggcaggtcgacaag
gagttctcgccggagatggacgccgagaaggcagacaagatgtacgatcgctgggacgac
gccgtcgaccgttcccgcgactgggcacaggaggaataa

DBGET integrated database retrieval system