KEGG   Haloarcula hispanica ATCC 33960: HAH_1278Help
Entry
HAH_1278          CDS       T01597                                 

Gene name
pecE
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hhi00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hhi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1227701..1228786)
Genome map
AA seq 361 aa AA seqDB search
MDDARAAVIALLLSAVLTLAVVPASVAGTQTAQETLTVDKDGSADYRSIQAAVDAADSGD
TVEVRPGTYYEEVRINENISLVAPDRAILDGSRFVNGTGVTVAGPAEPTVTGFTVRNYRF
GVMANGTNGDWTVSNTTVIAADVGVYAPNSSGNWTIEDAAVASTTYSGVFARETSGDWTI
RDTRFVAVGGDGADVRRSSGDWAVAAVVVDRSGADGVDASGTTGDWTVQNTEVRRSDTGV
KAIDSDGDWTVTDLTVRRSDTGLVTAFSGGAWTLENATLETRDIGVFSARTTGAWTIQNT
IIESRQQGIHAVKTNASWTVSESTVSVTAEQNAIGVDARSASEGWSLENVTIDSPDIKVA
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcacgagcagcagtaattgccctcttgctgtcggcagtgctgaccctcgcc
gtggtaccggcaagcgtagcaggaacacagacggcacaggagacactaaccgtcgacaaa
gacgggagtgccgactaccggtcgatacaggccgccgtggacgccgccgatagcggtgac
accgtcgaggtccggccgggcacctactacgaagaagtccgaatcaacgagaacatctcc
ctcgtcgcacccgaccgggcgatactggacggctcgcggttcgtcaacggtaccggcgtt
acggtggccggcccagccgaaccgaccgtcaccggatttaccgtgcggaactaccgcttt
ggtgtcatggccaacgggaccaatggcgactggacggtcagtaatacgaccgttatcgct
gccgacgtcggcgtctacgcgccgaattcgtccgggaactggactatcgaggacgccgcc
gtcgccagcacgacctacagcggcgtgttcgcccgcgagaccagcggcgactggacgatt
cgcgacactcgcttcgtcgctgtcggcggcgacggcgccgacgtccgcaggtcttccggc
gactgggcggtcgcagcggtcgtcgtcgaccggtccggcgcggacggcgtcgatgcctcc
gggacaactggcgactggacggtccagaacacggaggtccgtcgtagcgataccggcgtc
aaagctatcgacagcgacggcgactggacggtgaccgacctgacggtccgccggagcgac
accggcctggtgaccgctttctcgggcggtgcgtggacgctcgaaaatgccaccctcgaa
acccgggatatcggggtcttcagcgctcgaacgaccggcgcgtggaccatccagaatacg
atcatcgaaagccggcaacagggaatccacgccgtcaagaccaacgcgtcgtggactgtc
tctgaatcgaccgtctccgtgaccgccgagcagaacgccatcggtgtcgacgcccgctcc
gcgagcgagggctggtcgcttgagaacgtcaccatcgacagccccgatatcaaagtcgcc
gagtga

DBGET integrated database retrieval system