KEGG   Haloarcula hispanica ATCC 33960: HAH_1303Help
Entry
HAH_1303          CDS       T01597                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hhi00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hhi00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1253557..1254426
Genome map
AA seq 289 aa AA seqDB search
MASSTSHERLEVEPIDESSILFVDDDHYTSDTVCLVTGGGSGIGRATALAMAANGVTAVA
TDIDEDGLAEVADTAADLDLDGAVETVAGDLANDADIESIVETAASHGTVRYLANIAGLQ
HIDAIEDFPMETYDQMHDVMLRAPLALSKRVIPHIRGTDDGVGAIGNMASVHGHYVTSDK
VAYNVSKFGLRGLTQSIAAEGGDGLRGFSISTGYVKTPLVVDQIPDTAEQRGISVDEVID
DVMLGQARVKEMMDPIDVANLFVFGLSTHADHLNGGDLLFDGGMTTTYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagcacctctcacgaacggctcgaagtcgagcccatcgacgagtcctcgata
ctgttcgtcgacgacgaccactacacgagcgacactgtctgtctggtgaccggcggcgga
tcgggcatcggccgggcgacagcgctggcgatggccgccaacggggtgactgccgtcgcc
acggatatcgacgaagacggtctcgctgaggtcgcggacacggcggcggacctcgacctt
gatggggccgtcgagaccgtggccggcgacctcgcgaacgacgcggatatcgagtccatc
gtcgagaccgcggcctcccacggcaccgtacggtatctcgcgaacatcgccggcctccag
cacatcgacgccatcgaggacttcccgatggagacgtacgaccagatgcacgacgtaatg
cttcgcgcgccgctcgcgctgtcgaagcgcgtcatccctcacatccgcgggactgacgac
ggcgtaggtgccatcgggaacatggcatcggtccacggccattacgttacctcggataag
gtggcctacaacgtctcgaagttcggcctgcggggactgacacagtctatcgccgcggaa
ggcggtgacgggctccgtgggttctctatcagtaccggctacgtcaagacgccgctggtg
gtcgaccagattcccgacaccgccgagcaacgtggcatcagcgtcgacgaggtcatcgac
gacgtgatgctgggccaggcgcgggtcaaagagatgatggaccccattgacgtggcgaac
ctcttcgtgttcgggctctcgacacacgccgaccatctcaacggcggggacctgctgttc
gacggcggcatgacaacgacctacgagtga

DBGET integrated database retrieval system