KEGG   Haloarcula hispanica ATCC 33960: HAH_1304Help
Entry
HAH_1304          CDS       T01597                                 

Gene name
acs3
Definition
acyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_1304 (acs3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAH_1304 (acs3)
   00620 Pyruvate metabolism
    HAH_1304 (acs3)
   00640 Propanoate metabolism
    HAH_1304 (acs3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HAH_1304 (acs3)
   00680 Methane metabolism
    HAH_1304 (acs3)
Enzymes [BR:hhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HAH_1304 (acs3)
Lipid biosynthesis proteins [BR:hhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HAH_1304 (acs3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1254570..1256591
Genome map
AA seq 673 aa AA seqDB search
MSEQDHVDSIVHEPSHAFVESTNVWEFMQEYDIDNYDELIERTTTDLPEEPESGVEWFWD
LLPEYLDIEFFDAYDEVRDDSEGPQFTDWYPGGTINAAHNVLDRHAARDSPTRNTVALIW
EGEPGDVREVTYHELNRQASKVANYLESVGVGTGDTVGLYMPMVPEVASILYGCLKVGAI
AVPIFSGFGVDATATRIADAECSVLFTGDGFYRRGSGVHLKESADEAIKQAGEELGTTPV
EHTVVYDRLGIADDPDETIRWTRRDEWWDEAIETANDEYAAKELPSNQESMLLYSSGTTG
KPKGIVHTHAGALMQAAKEIYFGFDHKPSDRFFWVSDIGWMMGPWTLLGNHAFGGTVFMY
EGAPDHPEPDRFWEMIDRHDLTTFGVSPTAIRALRKKGDEWLEGHDLSSLRLLGSTGEPW
DPESWQWFHEHVGNEDCPIINISGGTEIMGCFLMPMPIQSLKPCTLGGPGLGMDIDIVDS
DGESIADTHERGYLVARDSCPSMTRSLWSGDDRYLHEYWSTWDDVWDHGDWAQKDEDGLW
FLHGRSDDVLNVAGRKVGPAEVEGAAMEHDAVNQAAAVGAPDDTTGTAVVLYAVLEPGYE
PDDDLRDDIRAAVGEELGKPFRPREVLFVDEFPKTQSGKIIRRAIAGVYRGEDLGDMSSI
ENPDALDEVREAS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaagaccacgtagactccatcgtccacgaaccgagccacgcgttcgtcgag
tcgacgaacgtctgggagttcatgcaggaatacgacatcgacaactacgacgaactcatc
gagcgaacgaccacggacctgccagaggaaccagaatccggcgtcgagtggttctgggac
ctgctcccggagtacctcgacatcgagttcttcgacgcgtacgacgaagtccgagacgat
agtgagggaccacagttcaccgactggtaccccggcgggaccatcaacgccgcccacaac
gttctagaccgccacgctgcgcgggacagcccgactcgaaacacagtcgcgctcatctgg
gagggtgaacccggcgacgttcgggaggtcacgtaccacgaactgaaccggcaggccagc
aaggtggcgaactacctggaatccgtcggcgtcggcaccggcgacactgtcggcctgtac
atgccgatggtccccgaggtggcgtcgatactgtacggctgtctcaaggtcggcgcgatc
gccgtgccgatcttctccgggttcggcgttgacgcgacggcgacccgcatcgccgatgcc
gagtgctccgtcctgttcactggtgacggcttctatcgccggggctccggtgtccacctc
aaggaaagcgccgacgaggccatcaagcaggccggcgaggaactcgggacgacaccggtc
gaacacactgtcgtctatgaccgcctcggtatcgcggacgaccccgacgagacgattcgc
tggacccgccgcgacgagtggtgggacgaagcgatagagaccgccaacgacgagtacgcg
gcgaaggaactcccgagcaaccaggagtcgatgctgctgtactcctccgggacgaccggg
aaaccgaagggcatcgtccacacgcacgccggcgcactcatgcaggcggccaaggagatc
tacttcgggttcgaccacaagccgagcgaccgcttcttctgggtgagcgacatcggctgg
atgatgggtccgtggacgctgctggggaaccacgccttcggcggcaccgtcttcatgtac
gagggcgcgccggaccaccccgaaccagaccgtttctgggagatgatcgaccgccacgac
ctcaccacgttcggcgtctcgccgaccgcaatacgggcactccgaaagaaaggggacgag
tggctggagggccacgacctctccagcctccggttgctgggctcgaccggcgaaccctgg
gaccccgagagctggcagtggttccacgagcacgtcggcaacgaggactgcccaatcatc
aatatctccggcggaaccgagatcatgggctgtttcctcatgccgatgccgattcaatcg
ctcaaaccctgcacactcggcggtccgggactggggatggacatcgacatcgttgattcc
gatggcgaatcgatagccgacacccacgagcgcggctatctggtcgccagggactcttgc
ccgtcgatgacccggtcgctctggtcgggcgacgaccgctacctgcatgagtactggtcg
acctgggacgacgtctgggaccacggcgactgggcgcagaaagacgaggacggcctctgg
ttcctccacggccgatcggacgacgtgctcaacgtcgccgggcggaaggtcgggccggcg
gaggtcgagggtgcggctatggaacacgacgccgtcaatcaggccgccgccgtcggtgcg
ccggacgacaccaccggcactgccgtcgtcctctacgccgtgctggaacccggctacgaa
cccgacgacgacctccgggacgacatccgcgccgccgtcggcgaggaactcggcaagccg
ttccggccccgagaagtactgttcgtcgatgagttccccaagacccagagcgggaaaata
atccgccgggcaatcgccggcgtctaccgcggcgaggacctgggcgacatgtccagcatc
gagaacccggacgcactggacgaggtccgcgaggcgtcgtag

DBGET integrated database retrieval system