KEGG   Haloarcula hispanica ATCC 33960: HAH_1445Help
Entry
HAH_1445          CDS       T01597                                 

Gene name
celM
Definition
endoglucanase/peptidase M42 family protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hhi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1383035..1384093)
Genome map
AA seq 352 aa AA seqDB search
MDTRRREFLESLLTTPGPSGYEADSQRVWLDYVSEFADEVRTDDYGNAVAKVEGGDTTVA
LAGHGDEIGFIVRDLTDDGFVKLGRIGGSDKTVSRGQHVTIHTADGPVSGVVGQTAIHLR
DSDDDSVPEIAEQHVDVGAEDGDEVESLVDRGDPVTFVQTLSELENGRLAARGMDNRIGI
WAAAEGLRRAAEAGADATVYAVSTVQEEVGVQGAKMVGFDLAPDVAIAVDVTHATDSPGS
PGKADTGVELGAGPVVARGSANHPVAVDALRETGKEEDIDIQLQATGSRTGTDADAFYTS
RGGIPSVNVGLPNRYMHTPVEVIDPDDLDVLADLLAGFAVRAADRAPFSVDV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggacacacgacgacgcgagttcctggaatcgcttctgacgacgcccggcccgtcgggg
tacgaggccgacagccagcgggtgtggctcgactacgtcagcgagttcgccgacgaggtc
cgaacggacgactacggcaacgccgtcgcgaaggtcgaaggtggcgacacgaccgtcgcg
ctcgcgggccacggcgacgaaatcggcttcatcgtccgggacctcaccgacgacggcttc
gtcaaactgggccgcatcggcggctcggacaagaccgtctcgcgcgggcaacacgtcacc
attcacacggccgacgggccggtatcgggcgtcgtgggccagaccgcgattcacctccgg
gattcggacgacgactccgtgccggagatcgccgaacagcacgtcgacgtgggggccgag
gacggtgacgaggtggaatcactcgtcgaccgcggcgacccggtgacgttcgtccagacg
ctgagcgaactggagaacggccgcctcgcggcccgaggaatggacaaccgtatcggcatc
tgggcggccgctgaggggcttcggcgcgcggcggaggccggtgcggacgcgacggtgtac
gccgtctccacggtgcaggaggaggtcggcgtccagggggcgaagatggtcgggttcgat
ctcgcgccggatgtcgctatcgccgttgacgtgacccacgcgacggactcgccgggttcg
ccgggcaaagccgacaccggcgtcgaactcggtgcgggaccggtcgtcgctcgcgggagc
gcgaaccatccggtcgccgtcgacgctctccgagagaccggcaaagaggaggacatcgac
attcagttgcaggcgacgggcagcaggaccggaaccgacgcggacgccttctacacttct
cggggtgggattccgtcggtcaacgtcggactgccgaaccgctacatgcacacaccggtt
gaggtcatcgaccccgacgacctcgacgtgctcgcagacctgctggccggcttcgccgtc
cgagcggccgaccgagcgccctttagcgtcgacgtgtag

DBGET integrated database retrieval system