KEGG   Haloarcula hispanica ATCC 33960: HAH_1704Help
Entry
HAH_1704          CDS       T01597                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (membrane anchor protein) (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAH_1704 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HAH_1704 (sdhD)
   00650 Butanoate metabolism
    HAH_1704 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HAH_1704 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1652117..1652482
Genome map
AA seq 121 aa AA seqDB search
MAEHYSSFDRGGRRWLFQRLTAVFLVGVLAFHFMLLHFVNHAADLTFLGTQARMNRPWYL
ITMWLFLVTATFHGVNGVYNALVNQGLTGSRKNAVKYLLGIAGILLIVQGTRVSLAMTTL
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacactactcctccttcgaccgtggcgggcgtcgctggctgttccagcggctg
acggcagtgttcctcgtcggcgtgctcgcgttccacttcatgctgttgcacttcgtgaac
cacgccgcagacctcaccttcctgggtacgcaggcccgaatgaaccgaccctggtatctc
atcacgatgtggctgttcctcgtcaccgccacgttccacggcgtcaacggcgtgtacaac
gcgctggtcaaccaaggactcaccggctcccggaagaacgcagtcaagtacctgctcggc
atcgccggcatcctgctcatcgtgcaggggacccgcgtgtcgctggccatgacaaccctc
gtctga

DBGET integrated database retrieval system