KEGG   Haloarcula hispanica ATCC 33960: HAH_1977Help
Entry
HAH_1977          CDS       T01597                                 

Gene name
adh4
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
hhi  Haloarcula hispanica ATCC 33960
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:hhi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HAH_1977 (adh4)
Enzymes [BR:hhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     HAH_1977 (adh4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1908183..1909223
Genome map
AA seq 346 aa AA seqDB search
MRAARLHEYTHDMSNGLSIDEVDAPQVASGDDVIVEVEGAGWCQTDNHIIEGMWDQYVPQ
DLPMTLGHENAGTVVETGDDVDIVSEGDQVICHPVQTCGTCRPCRQGETMYCENDAFNGL
TTDGGFADQLLTSDRSVIPLPGGVDPADIAPHADAGITAYHAAKKAVDGLNPGDTAVVIG
IGGLGHIGLQCLDAMCAANLVAVDIKQSARDLADDLGAHYTIDPESEDVASEVEAISDGV
GAAQVLDFVGADETTALAPDICATGGDHHIIGYGGHIHEPAQALVNGEFAYQGNIVGQYT
ELQELVALVERGAVDLHTTQYDLGEVNTVAQMLENREIDGRAVITP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccagactccacgagtacacgcacgacatgtcgaacgggctttcgatagac
gaggtggacgcaccacaggtcgcgtcgggggacgacgtcatcgtcgaggtcgaaggggcc
ggctggtgccagactgacaatcacatcatcgaggggatgtgggaccagtacgtcccgcag
gacctcccgatgacgctgggccacgagaacgccgggacagtcgtcgagaccggcgacgac
gtcgatatcgtctcggaaggcgaccaggtcatctgtcatccggtccagacctgtggcacc
tgccgaccgtgccggcaaggtgagacgatgtactgcgagaacgacgcgttcaacggcctg
acgaccgacggcggcttcgccgaccagctactgaccagcgaccggtcggtcatcccgctg
cccgggggcgttgacccggccgacatcgccccgcacgccgacgccggtatcacggcctac
cacgcggcgaagaaagccgtcgacggactcaatccgggcgacactgcggtcgtcatcggt
atcggcgggctcggacacatcggtctccagtgtctcgacgcgatgtgtgccgccaacctc
gtcgccgtcgacatcaagcagtccgcccgcgacctcgctgacgacctcggcgcacactac
accatcgaccccgaaagcgaagacgtcgccagcgaggtcgaggccatcagcgacggcgtc
ggcgcggcgcaggtgctcgatttcgtcggggccgacgagacgacagcgctcgcgcccgat
atctgtgccaccggcggcgaccaccacatcatcggctacggcggccacatccacgaaccc
gcacaggcgctcgtcaacggcgagttcgcctatcagggcaacatcgtcggccagtacacc
gagctgcaggaactggtcgcgctcgtcgagcgcggcgcggtcgacctgcacacgacccag
tacgacctgggcgaggtaaacaccgtcgcacagatgctcgaaaaccgagagatcgacggt
cgggcagtcatcacgccctga

DBGET integrated database retrieval system