KEGG   Haloarcula hispanica ATCC 33960: HAH_1977Help
Entry
HAH_1977          CDS       T01597                                 

Gene name
adh4
Definition
(GenBank) alcohol dehydrogenase (EC:1.1.1.1)
Organism
hhi  Haloarcula hispanica ATCC 33960
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:1908183..1909223
Genome map
AA seq 346 aa AA seqDB search
MRAARLHEYTHDMSNGLSIDEVDAPQVASGDDVIVEVEGAGWCQTDNHIIEGMWDQYVPQ
DLPMTLGHENAGTVVETGDDVDIVSEGDQVICHPVQTCGTCRPCRQGETMYCENDAFNGL
TTDGGFADQLLTSDRSVIPLPGGVDPADIAPHADAGITAYHAAKKAVDGLNPGDTAVVIG
IGGLGHIGLQCLDAMCAANLVAVDIKQSARDLADDLGAHYTIDPESEDVASEVEAISDGV
GAAQVLDFVGADETTALAPDICATGGDHHIIGYGGHIHEPAQALVNGEFAYQGNIVGQYT
ELQELVALVERGAVDLHTTQYDLGEVNTVAQMLENREIDGRAVITP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccagactccacgagtacacgcacgacatgtcgaacgggctttcgatagac
gaggtggacgcaccacaggtcgcgtcgggggacgacgtcatcgtcgaggtcgaaggggcc
ggctggtgccagactgacaatcacatcatcgaggggatgtgggaccagtacgtcccgcag
gacctcccgatgacgctgggccacgagaacgccgggacagtcgtcgagaccggcgacgac
gtcgatatcgtctcggaaggcgaccaggtcatctgtcatccggtccagacctgtggcacc
tgccgaccgtgccggcaaggtgagacgatgtactgcgagaacgacgcgttcaacggcctg
acgaccgacggcggcttcgccgaccagctactgaccagcgaccggtcggtcatcccgctg
cccgggggcgttgacccggccgacatcgccccgcacgccgacgccggtatcacggcctac
cacgcggcgaagaaagccgtcgacggactcaatccgggcgacactgcggtcgtcatcggt
atcggcgggctcggacacatcggtctccagtgtctcgacgcgatgtgtgccgccaacctc
gtcgccgtcgacatcaagcagtccgcccgcgacctcgctgacgacctcggcgcacactac
accatcgaccccgaaagcgaagacgtcgccagcgaggtcgaggccatcagcgacggcgtc
ggcgcggcgcaggtgctcgatttcgtcggggccgacgagacgacagcgctcgcgcccgat
atctgtgccaccggcggcgaccaccacatcatcggctacggcggccacatccacgaaccc
gcacaggcgctcgtcaacggcgagttcgcctatcagggcaacatcgtcggccagtacacc
gagctgcaggaactggtcgcgctcgtcgagcgcggcgcggtcgacctgcacacgacccag
tacgacctgggcgaggtaaacaccgtcgcacagatgctcgaaaaccgagagatcgacggt
cgggcagtcatcacgccctga

DBGET integrated database retrieval system